SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011395 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011395
Domain Number 1 Region: 216-281
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000133
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000219
Further Details:      
 
Domain Number 2 Region: 284-322
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000011
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011395
Domain Number - Region: 61-116
Classification Level Classification E-value
Superfamily Chromo domain-like 0.07
Family Chromo barrel domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011395   Gene: ENSMPUG00000011485   Transcript: ENSMPUT00000011583
Sequence length 615
Comment pep:novel scaffold:MusPutFur1.0:GL897161.1:1271179:1311745:-1 gene:ENSMPUG00000011485 transcript:ENSMPUT00000011583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPERQIPFHDVRFPPPVGYNKDIN
ESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKP
ATKDTFHKIKLDVPEDLRQMCAKESAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKR
AHMLIDMHFRSLRTKLSLILRNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHGAN
IQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKN
GKLIQEIVDKSGVVRVRIEAENEKSVPQEEEIMPPNSLPSSNSRVGPTPPEEKKHIDIKE
NSTHFSQPNSTKVQRVLVVSSIVAGESQKPELKAWQGMVPFVFVGTKDSIANATVLLDYH
LNYLKEVDQLRLERLQIDEQLRQIGASSRPPPNRTDKEKGYVTDDGQGMGRGSRPYRNRG
HGRRGPGYTSGTNSEASNASETESDHRDELSDWSLAPTEEERENFLRRGDGRRRGGGGRG
QGGRGRGGGFKGNDDHSRTDNRPRNPREAKGRTADGSLQNTSSEGNRLRTGKDRNQKKEK
PDNVDGQQPLVNGVP
Download sequence
Identical sequences M3YJ88
XP_004777991.1.14098 ENSMPUP00000011395 ENSMPUP00000011395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]