SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011566 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011566
Domain Number 1 Region: 610-910
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-73
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 32-191
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.02e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011566   Gene: ENSMPUG00000011659   Transcript: ENSMPUT00000011757
Sequence length 919
Comment pep:novel scaffold:MusPutFur1.0:GL897304.1:96015:110745:-1 gene:ENSMPUG00000011659 transcript:ENSMPUT00000011757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGALTSLPLLLLLLLVATGDADMKGHFDPAKCRYALGMQDRTIPDGDISASSSWSDST
AARHSRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSPS
YRLRYSRDGHRWMDWRDRWGQEVILGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVC
LRVELYGCLWKDGLLSYTAPVGQTMYLSEAVHLNDSTYDGHTTHAVGGLLYGGLGQLADG
VVGLDDFRKSQELRVWPGYDYVGWSNHSFPAGYVEMEFEFDRLRVFQAMQVHCNNMHTLG
ARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAVSVPLGGRVGRFLQCRFLFAG
PWLLFSEISFISDVMNDSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGS
PTAILIGCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINN
RPGPLEPPPYQEPRPRGNPPHSAPSVPNSSALLLSNPAYRLLLATYARPPRGPGPPTPAW
AKPTNTQACSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPG
AAGDGPPRVDFPRSQLRFKEKLGEGQFGEVHLCEVENPQDLVSLDFPLNVCKGHPLLVAV
KILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLS
AHQLEDKVAEGAPRDGEAAPGPTISYPMLLHVVAQIASGMRYLATLNFVHRDLATRNCLV
GENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLW
EVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPLGLYELMLRCWSREPEQ
RPPFSQLHRFLAEDALNTV
Download sequence
Identical sequences M3YJQ9
ENSMPUP00000011566 XP_012906003.1.14098 XP_012906005.1.14098 XP_012906006.1.14098 XP_012906007.1.14098 XP_012906008.1.14098 XP_012906009.1.14098 ENSMPUP00000011566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]