SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011691 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011691
Domain Number 1 Region: 367-519
Classification Level Classification E-value
Superfamily TRAF domain-like 6.54e-46
Family MATH domain 0.0000000293
Further Details:      
 
Domain Number 2 Region: 64-136
Classification Level Classification E-value
Superfamily RING/U-box 1.3e-18
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 186-278
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000915
Family SIAH, seven in absentia homolog 0.018
Further Details:      
 
Domain Number 4 Region: 129-185
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000981
Family SIAH, seven in absentia homolog 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000011691
Domain Number - Region: 313-365
Classification Level Classification E-value
Superfamily Tropomyosin 0.0281
Family Tropomyosin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011691   Gene: ENSMPUG00000011785   Transcript: ENSMPUT00000011883
Sequence length 541
Comment pep:known scaffold:MusPutFur1.0:GL896949.1:10122469:10139666:-1 gene:ENSMPUG00000011785 transcript:ENSMPUT00000011883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLHCENSCGSSHSESDCCAAMTSSCSAAAKDDSVSGTASTGNLSSSFMEEVQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLQKMELRHLEDHQAHCEFTLMNCPQCQRPFQKCQLNIHILK
ECPRRQVSCMNCAVLMAFEDKEIHDQNCPLANVICEYCNTMLIREQMPNHYDLDCPTAPV
PCTFSTFGCHVKMQRNHLARHLQENTQSHMRMLAQAVQSLSLALAPVPPRDMPPYDSSSV
SRVSASCHPEVHNFQETIQQLEGRLVRQDHQIRELTAKMETQSMHVSELKRTIRTLEDKV
AEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQ
RCANYISLFVHTMQGEYDSHLPWPFQGTIRLAILDQSEAPVRQNHEEIMDAKPELLAFQR
PTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDSG
I
Download sequence
Identical sequences M3YK34
ENSMPUP00000011691 ENSMPUP00000011691 XP_004756057.1.14098 XP_004756058.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]