SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011807 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011807
Domain Number 1 Region: 142-327
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.13e-50
Family Nucleotide and nucleoside kinases 0.0000000171
Further Details:      
 
Domain Number 2 Region: 2-67,106-141
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-24
Family SH3-domain 0.0000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011807   Gene: ENSMPUG00000011897   Transcript: ENSMPUT00000012000
Sequence length 523
Comment pep:novel scaffold:MusPutFur1.0:GL896956.1:2946350:2987676:1 gene:ENSMPUG00000011897 transcript:ENSMPUT00000012000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKQGKFYS
SKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEGNDIQANHRSPKPSANSVTSPH
SKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIS
ITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADT
INHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELF
DVILDENQLEDACEHLADYLEAYWKATHPPSSHLPNPLLSRTLATSALPSSPTQASNSQG
SQGDQRTERSAPARSASQPEEEPCPEPVKKPQHRSSSSAQHHSHRSGTSRGLSRQETFDS
ETQESRDSAYVEPKEDYSHEHVDHYAPHRDHNHREEPHGSSEHRHRESRHRSRDLDREQD
HNECNKQRSRHKSKDRYCDKDGEGLSKKRNEAGEWNRDVYIRQ
Download sequence
Identical sequences M3YKF0
XP_012914350.1.14098 ENSMPUP00000011807 ENSMPUP00000011807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]