SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011872 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011872
Domain Number 1 Region: 104-210
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.62e-19
Family PWWP domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011872   Gene: ENSMPUG00000011964   Transcript: ENSMPUT00000012067
Sequence length 360
Comment pep:known scaffold:MusPutFur1.0:GL896941.1:6331388:6436714:-1 gene:ENSMPUG00000011964 transcript:ENSMPUT00000012067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPRLNAFMEKEKLDSKIIVEYCNTAMDPSAKNSMYVNKVWVQCESESCLKWRLLSSKD
AARVDHNKPWYCFMNADSRYNNCSVSEEDFPEESQLHESGFKIVYSQLPLGSLVLVKLQN
WPSWPGILCPDSFKGKYVIYDLDGNVEQYHVEFLGDPHSRSWINATFVGYYSITLKPEKC
KKKKKWYKSALQEARLLYGYSPEQRLEMCRLAKQDKSKADGKVAVVAKKRMQVSKNTTEK
KKPKFRRKRKAILKCSFENVCSDDALSKENMVVSETEVLLKELEQMLQQALDSTGAPDEP
EEERGEELTKCSSEVPAGSPFENHYEEDYLVIDGIKLKAGECIENITNKFKEIDALMSEF
Download sequence
Identical sequences M3YKL5
XP_012912622.1.14098 ENSMPUP00000011872 ENSMPUP00000011872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]