SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012189 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012189
Domain Number 1 Region: 623-1018
Classification Level Classification E-value
Superfamily RNI-like 1.35e-78
Family 28-residue LRR 0.00000533
Further Details:      
 
Domain Number 2 Region: 3-91
Classification Level Classification E-value
Superfamily DEATH domain 1.05e-24
Family Pyrin domain, PYD 0.0042
Further Details:      
 
Domain Number 3 Region: 209-302,333-386
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000329
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012189
Domain Number - Region: 102-179
Classification Level Classification E-value
Superfamily USP8 N-terminal domain-like 0.0471
Family USP8 N-terminal domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012189   Gene: ENSMPUG00000012286   Transcript: ENSMPUT00000012389
Sequence length 1035
Comment pep:known scaffold:MusPutFur1.0:GL897176.1:1701319:1744508:1 gene:ENSMPUG00000012286 transcript:ENSMPUT00000012389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMTSVRCKLARYLEDLEDADFKKFKMHLQDYPSQKGCRPLPRSQTEKADHMDLATLMID
FNGEEKAWAMAVWIFAAINRRDLYEKAKRDAPEWDNVHVVCQEESLEEEWMGLLGYLTRI
SICKKRKDYCKKYKKHVRSRFQCIKDRNARLGESVNLNKRYTRLRLVKEHQSQQEREHEL
LAIGRTSARMLDSPVSSLNMELLFEPDDQHSEPVHTVVFQGAAGIGKTILARKIMLDWAS
EKIYQDRFDYLFYIHCREVSLGTRRSLGDLIVSCCPDPNPPICKIVSKPSRILFLMDGFD
ELQGAFDEHTETLCTNWQKVERGDILLSSLIRKRLLPEASLLITTRPVALEKLQHLLDRP
RHVEILGFSEAKRKEYFFKYFSDEQQATEAFRLIQENEVLFTMCFIPLVCWIVCTGLKQQ
MDSGKSLAQTSKTTTAVYVFFLSSLLQSHGENQKHQVSANIRGLCSLAADGIWNQKILFE
ECDLRNHGLQRADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEEQGELR
NLPWRSSKLPNRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKISQHI
RLELLKWIKEKAKAKNLQIQPSQLELFYCLYEMQEEDFVQKAMGHFPKIEISLSTRMDHV
VSSFCIENCHSMESLSLRLLHNSSKEEEEEEEEEGEMQLSEVDHCVRLDPHAACTHRLVN
CYVTLSLWQGLFSVLSTNSLNLTELNLSDNALGDPGVQVLCEMLQRPGCNIRRLWLGRCC
LSHHCCFNISSVLSSNQKLMELDLSHNTLGDFGIRLLCVGLRHLFCNLKKLWLVSCCLTS
ACCEDLASVLSTNQSLTRLYLGENALGDAGVGILCEKAKHPQCKLQKLGLMNSGLTSGCC
PALSSVLSTNQKLTHLYLRGNSLGDTGVKLLCEGLLHPNCKLQILELDGCSLTSHCCWDL
STLLTSNRSLRELSLGSNDLGDLGVMLLCEVLKQQGCLLKSLKLCEMYFNYDTKCALETL
QEEKPELTIVFEPFW
Download sequence
Identical sequences M3YLI2
XP_004778488.1.14098 XP_012904391.1.14098 ENSMPUP00000012189 ENSMPUP00000012189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]