SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012249 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012249
Domain Number 1 Region: 7-321
Classification Level Classification E-value
Superfamily Subtilisin-like 3.01e-89
Family Subtilases 0.00000000132
Further Details:      
 
Domain Number 2 Region: 316-466
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.64e-43
Family Proprotein convertase P-domain 0.0000838
Further Details:      
 
Domain Number 3 Region: 1308-1470
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.33e-32
Family Growth factor receptor domain 0.00052
Further Details:      
 
Domain Number 4 Region: 1409-1570
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.58e-30
Family Growth factor receptor domain 0.00066
Further Details:      
 
Domain Number 5 Region: 495-657
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.02e-29
Family Growth factor receptor domain 0.00018
Further Details:      
 
Domain Number 6 Region: 1073-1219
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.09e-26
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 7 Region: 748-905
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.23e-26
Family Growth factor receptor domain 0.00057
Further Details:      
 
Domain Number 8 Region: 1212-1354
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.23e-24
Family Growth factor receptor domain 0.00056
Further Details:      
 
Domain Number 9 Region: 847-991
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-23
Family Growth factor receptor domain 0.0018
Further Details:      
 
Domain Number 10 Region: 643-755
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.34e-19
Family Growth factor receptor domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012249
Domain Number - Region: 1562-1624
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0118
Family Growth factor receptor domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012249   Gene: ENSMPUG00000012343   Transcript: ENSMPUT00000012449
Sequence length 1753
Comment pep:known scaffold:MusPutFur1.0:GL897068.1:865058:1191506:1 gene:ENSMPUG00000012343 transcript:ENSMPUT00000012449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGND
LDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKS
VSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRS
KDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQR
CTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFK
VSHLYGFGLMDAEAMVTEAEKWTTVPQQHVCVESTDRQIKTIRPNSAVRSIYKASGCSDN
PNHHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANRLFDHSMEGFKNWEFMTI
HCWGERATGDWILEVYDTPSQLRNFKTPGKLKEWSLVLYGTSVQPYSPTNEFPKVERVRY
SRVEDPTDDYGTDDYAGPCDPECSEVGCDGPGPDHCNDCLNYYYKLKNNTRICVSSCPSG
HYHADKKRCRKCAPNCESCFGSHGDQCLSCKYGYFLNEEINSCVLHCPDGSYPDPKKNLC
RKCSENCKTCTEFHNCTECRDGLSLQGSQCSVACEDGQYFNGHDCQPCHRFCAACAGPGA
DACSSCAEAYFMEDGRCVQTCSLSYYLDRSAENGHKSCKKCDASCLTCSGPGFKNCTSCL
GGYLLDSGTCQMGAVCKDGEYIDEHGHCQVCEASCAKCWGPTREECTDCPITRTFDNGRC
VFKCPSGTFEFQNECHLCHHTCQECQGNEPSNCTSCGVDKLGQERFLYQGECWESCPAGH
YPAEGHTCLPCSDNCELCHRAHICTRCMDGYFIVPSNHTCQKLECGQGEVQDPDYEECVP
CEEGCLGCSLDNPGTCTSCTTGYYMFEQHCYKTCPEKTYREESECKACETNCGNCDQRQC
YWCEEGFFLLDGSCVRRCGPGFYGDPELGQCERCHPACETCTGFGYQQCSSCREGQQLRQ
GTCAGPAQVQVEGRLGNDNKEPGPTESPSSARSLPQKRLRKFQIKRDILRGHQPCHPSCK
TCNESATLCTSCPKGTYLLAQACVSSCPEGTWPSARSGSCENCTEDCVSCSGADLCRKCQ
TSPDFPLVLHKGRCYTRCPEGFYAADSTCKPCSTPCRTCEGNATNCHSCQGSLTLHQGAC
REACPERHVAVEGVCKACPEMCQDCIHEKTCKECMPESFLYQDMCHQSCPRGFYKDTREC
IPCHEDCLECSGPSADDCDLCAETSLVLYDGRCLDECPVGTYYEKETKDCRDCHKSCQTC
SSPGTCVTCQEGLLVNHHGDCVPHKECAPSEYWDVEALGCKPCHAKCFRCTGPAEDQCHA
CLRDHLLLNTTCVQDCPEGYYADEDSHRCIPCHSSCRTCEGRHSTQCLSCHPGSFQLEKE
CLLQCREGYYAEISTRRCERCSKSCRTCGGPRPTDCLSCDTFFFLLRSKGECLRTCPEHY
YGEQNTRTWTCERCHPTCDKCKGKGALNCLSCVWSYHLAGGICASDCLVGEYRVGEGEKF
NCEKCDGSCVECKGPGTKNCTVCPANLVLFVDDGRCLHCCNGSDSSNAQDCCDCRNTTEE
CIFQASDIGTASEHTKITLLITSSIMLVLLLGAAVIVWRKSRGRVQPVAKAGYEKLANPS
KSYVSYKSSHSENTSFEEDQVIEYRDRDYDEDDDDDIVYMGQDGTVYRKFKYGLLDDDDE
DELEYDDESYSYQ
Download sequence
Identical sequences M3YLP2
ENSMPUP00000012249 ENSMPUP00000012249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]