SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012830 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012830
Domain Number 1 Region: 59-93,145-213
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-23
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 217-329
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-20
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012830   Gene: ENSMPUG00000012929   Transcript: ENSMPUT00000013038
Sequence length 461
Comment pep:novel scaffold:MusPutFur1.0:GL897050.1:1705167:1712159:-1 gene:ENSMPUG00000012929 transcript:ENSMPUT00000013038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDRSVCTRARGPRVPRPGAHGPGGSGRAASLVLPTVTAAPQEPPARPPQAGSGIGRAPGR
AMRSTTLLALLALVLLYLVSGALVFQALEQPHEQQAQRELGEVREKFLRAHPCVSDQDLG
ILIKDVADALGGGADPDINSSSNSNHSAWDLGSAFFFSGTIITTIGYGNAALRTDAGRLF
CIFYALVGIPLFGILLAGVGDRLGSSLRRGIGHIEAIFLKWHVPPGLVRILSAVLFLLIG
CLLFVLTPTFVFCYVEGWSKLEAIYFVVVTLTTVGFGDYVAGASPNQSNAAYQPLVWFWI
LLGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRVGPTAPPPLE
KERPFLPPPPCPAQPAGRPPSPLPVKAEPPSPSSPSTPPTASALDYPSENLAFIDESSDT
QSERGCALPRAPRGRRRPPNPPRKPARPRGPVRPRERGVPA
Download sequence
Identical sequences M3YNC3
ENSMPUP00000012830 ENSMPUP00000012830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]