SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012859 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012859
Domain Number 1 Region: 318-490,535-708
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.89e-131
Family Mammalian PLC 0.00000000238
Further Details:      
 
Domain Number 2 Region: 949-1196
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 3.4e-58
Family C-terminal domain of PLC-beta 0.00023
Further Details:      
 
Domain Number 3 Region: 148-314
Classification Level Classification E-value
Superfamily EF-hand 3.81e-50
Family EF-hand modules in multidomain proteins 0.00000959
Further Details:      
 
Domain Number 4 Region: 17-146
Classification Level Classification E-value
Superfamily PH domain-like 6.27e-43
Family Pleckstrin-homology domain (PH domain) 0.0000369
Further Details:      
 
Domain Number 5 Region: 729-842
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.17e-23
Family PLC-like (P variant) 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012859   Gene: ENSMPUG00000012959   Transcript: ENSMPUT00000013068
Sequence length 1233
Comment pep:known scaffold:MusPutFur1.0:GL897050.1:1733435:1748581:-1 gene:ENSMPUG00000012959 transcript:ENSMPUT00000013068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDSNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWTEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHQPSTGVPNS
SVRKRPLEQSNSALSESSAATTEPSSPQLGSPSSDSCPGLSNGEEVALEKPSLEPRKSLG
EDGLQRGTDALGSADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEP
VKFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNY
MPQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVI
VDGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEE
PFDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALL
IYTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASPETCQETPSQQ
LGSQLTPNPTPSPLDTSPPLRCGAGLCGRGVGRSRGARQPPPSPPVLCCSEVAPASLDEL
RGHKVLVKLRGRQERELRELHKKHQRKAVALTRRLLSGLAQARTEGRCRPRPGVPGGENE
EEEEEEAKQYQEFQKRQVQSLLELREAQADTEAERRLEHLRQAQLRLREIVLEAHTTQIK
RLKEVNEREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLEE
AQKQRHERLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGETPEGLGD
GHLVACASNGHAPGSSGHLSGADSESQEENTKL
Download sequence
Identical sequences M3YNF2
ENSMPUP00000012859 ENSMPUP00000012859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]