SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012862 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012862
Domain Number 1 Region: 83-271
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 8.11e-56
Family CRAL/TRIO domain 0.000000093
Further Details:      
 
Domain Number 2 Region: 277-392
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 5.23e-37
Family Supernatant protein factor (SPF), C-terminal domain 0.00000269
Further Details:      
 
Domain Number 3 Region: 2-73
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.16e-19
Family CRAL/TRIO N-terminal domain 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012862   Gene: ENSMPUG00000012962   Transcript: ENSMPUT00000013071
Sequence length 397
Comment pep:known scaffold:MusPutFur1.0:GL897019.1:1902363:1920463:1 gene:ENSMPUG00000012962 transcript:ENSMPUT00000013071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRVGDLSPQQQEALARFRDNLQDLLPTLPNADEYFFLRWLRARNFDLQKSEDMLRKHM
EFRKQQDLDNILSWKPSEVIQLYDSGGLSGYDYEGCPVWFDIIGTLDPKGLLLSASKQEL
IRKRIRVCELLLRECELQSQKLGRKIETVLMVFDMEGLSLKHLWKPAVEVYQQFFAILEA
NYPETIKNLIVIRAPKLFPVAFNLVKFFMSEETQRKIVILGGNWKQELPKFISPDQLPVE
FGGTMTDPDGNPKCLTKIKYGGDVPKSYYLRNQVKTQYEHTVTVARGSFMQVENEILFPG
CVLRWQFASEGADIGFGVFLKTKMSEQKQAGDMVEVLPIQRCKAHVVPEDGSLTCLKAGV
YILRFDNTYSLMHAKKVSYTVEVLLPDKASEEKLQGL
Download sequence
Identical sequences M3YNF5
ENSMPUP00000012862 ENSMPUP00000012862 XP_004766489.2.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]