SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012923 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012923
Domain Number 1 Region: 389-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-37
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 86-241,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.56e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.078
Further Details:      
 
Domain Number 3 Region: 994-1027
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000337
Family LIM domain 0.01
Further Details:      
 
Domain Number 4 Region: 1028-1057
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000238
Family LIM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012923   Gene: ENSMPUG00000013022   Transcript: ENSMPUT00000013132
Sequence length 1124
Comment pep:novel scaffold:MusPutFur1.0:GL896930.1:3675906:3810050:1 gene:ENSMPUG00000013022 transcript:ENSMPUT00000013132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQSQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTW
KAKALWYKLDKRGSHKEYKRGRSCMNTKCLIIGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPADHCLSDFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDFALNH
YGQPDVAMFDFTSMYASENAALVRERQSHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWDQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSSCVR
PHQVKHLYITKELHPCPLERLGSVRRSMSLSRRELDIRPSKLLTWCQQQTEGYQHVEVTD
LTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMA
STQEPDKLSMVMYLSKFYELFRATPLKPVDSWGKNYGENADLSLAKSSISHNYLNLTFPR
KRMPRVDTQTEDSDMNKRRRKGFNNLDEPSAYPSRGLRSSPEGSSGREVGSQNKVKSMAS
QLLAKFEENSRNPSLLRQECRVSGIGKPVLRTFSDPPINPRCYRPEEPTPSPSPPLKRQF
PSVVVTGHVLRELNQVSAGGGCPNRPWRARAKSDLQLGGPEAPAGLPPTCQGALALSGVL
RRLQQVEDKILQKRAQNLANREFHKKNIKEKAAHLASMFGHGDFPQNKLLSKGLSLTHPP
ASSSCLPSPDPAAASSPSTVDSVSPARKAKKSPQGSEGHTCHIILPHAELTVGKVSSGIG
AAAEVLVNLYMNDHRPKTQATSPDLESMRKVFPLNLGGSDTCYFCKKRVYVMERLSAEGH
FFHRECFRCSVCASTLRLAAYAFDGDEGKFFCKPHFIHYKTNSQQRKRRAELKQQREEEG
PWKEQEAPRRDTPVESSCAAAAIGTPEGSPPVRFSLPVLHPLLG
Download sequence
Identical sequences M3YNL6
ENSMPUP00000012923 ENSMPUP00000012923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]