SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013126 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013126
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.09e-90
Family G proteins 0.0000000000584
Further Details:      
 
Domain Number 2 Region: 520-628
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000126
Family Pleckstrin-homology domain (PH domain) 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013126   Gene: ENSMPUG00000013224   Transcript: ENSMPUT00000013337
Sequence length 864
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:6417037:6460821:-1 gene:ENSMPUG00000013224 transcript:ENSMPUT00000013337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSD
LANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKL
QSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGA
RINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKI
REPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLID
IELAYMNTNHEDFIGFANAQQRSNQMNKKKASGNQDEILVIRKGWLTINNIGIMKGGSKE
YWFVLTAENLSWYKDDETHSLSETDMSVLPDNYSLNHLHEWVSSLLPSPPAPSCRNVYKD
YRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQV
ETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESA
EQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRYQGRPP
RPGECRPGLPPPPRPLGSRGPHPSPPPHPQLLLPPPPPPGLGCPCLTPSLPPSLRSLSAF
SPTASRSGQASPSRPESPRPPFDL
Download sequence
Identical sequences M3YP69
ENSMPUP00000013126 ENSMPUP00000013126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]