SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013238 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013238
Domain Number 1 Region: 63-123
Classification Level Classification E-value
Superfamily Chromo domain-like 1.62e-18
Family Chromo domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013238   Gene: ENSMPUG00000013337   Transcript: ENSMPUT00000013450
Sequence length 454
Comment pep:novel scaffold:MusPutFur1.0:GL897167.1:915726:947665:1 gene:ENSMPUG00000013337 transcript:ENSMPUT00000013450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVVVAAVAAAAAAEGESVNAVPVAGADSNGEPPEVEGEGVGAVGEEKDAATKGAEAVG
DSEEDGEDVFEVEKILDMKTEGGKILYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKK
VVENKAKPVKKDIQRLSLNNDIFEANSDSDQQSETKEDTSPKKKKKKLRYREEKSPDDMK
KKKAKTGKLKDKSKPDLESSSESFAFDLRTKKRISEAKEELKESKKPKKEDTKETKELKK
VKKGEIRDLKNKLREDSRENRKTKKDKCLESQLESESSILNDSPFQEDDSEDLHSDNREE
KQKIKSIKDKAGQDAIQDDFDKQPDDFVSADEDADVKAKRKRKKLRKTEELKESKTLENR
NLFLEKKTIYKKQRNQDKGRSTTEFDKLLPLPVQTQRSSRAGVEERGLRSPDSGGEEKEI
KKNEPKEKNQKRHDLDKEEKGRKEPKGLKSECEY
Download sequence
Identical sequences M3YPI0
ENSMPUP00000013238 ENSMPUP00000013238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]