SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013265 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013265
Domain Number 1 Region: 236-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.77e-17
Family TRASH domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013265   Gene: ENSMPUG00000013364   Transcript: ENSMPUT00000013477
Sequence length 1295
Comment pep:known scaffold:MusPutFur1.0:GL897167.1:1258425:1342033:1 gene:ENSMPUG00000013364 transcript:ENSMPUT00000013477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTGSVGGLELTDQTPVLLGSTAMATSLTNVGNSFSGPPNPLVARSNKFQNSSVEDDDDV
VFIEPVQPPPPSAPVVTDQRTVTFSSSKNEELQGNDSKILPSSKELASQKGSVSETIVID
DEEDMETNQGQEKNSSNFIERRPPETKNRTNDVDFPTSSFSRSKTKTGVGPFNPGRMNVA
GDVFQNGESATHHNPDSWISQSASFPRNQKQPGVDSLSPVASLPKQIFQPSAQQQQQQQQ
PTKPVKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKPAPKKLCVMCKKDITT
MKGTIVAQVDSSESFQEFCSTSCLSLYEDKQNPTKGALNKSRCTICGKLTEIRHEVSFKN
MTHKLCSDHCFNRYRMANGLIMNCCEQCGEYLPSKGAGNNVLVIDGQQKRFCCQSCVSEY
KQVGSHPSFLKEVRDHMQDSFLMQPEKYGKLTTCTGCRTQCRFFDMTQCIGPNGYMEPYC
STACMNSHKTKYAKSQSLGIICHFCKRNSLPQYQATMPDGKLYNFCNSSCVAKFQALSMQ
SSSNGQFVAPSDIQLKCNYCKNSFCSKPEILEWENKVHQFCSKTCSDDYKKLHCIVTYCE
YCQEEKTLHETVNFSGVKRPFCSEGCKLLYKQDFARRLGLRCVTCNYCSQLCKKGATKEL
DGVVRDFCSEDCCKKFQDWYYKAARCDCCKSQGTLKERVQWRGEMKHFCDQHCLLRFYCQ
QNEPNMTTQKGPENLHYDQGCQTSRTKMTGSAPPPSPTPNKEMKNKAVLCKPLTMTKATY
CKPHMQTKSCQTDDNWKTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLPA
SLGSSEKIPAVAEELKSKVSSDPLDTELLTMTDMMTEDEGKTEAANINSVIIETDIIGSD
LLKNSDPETQSNMPDVPYEPDLDIEIDFPRAAEELDMENEFLLPPVFGEEYEEQPRPRSK
KKGAKRKAVSGYQSHDDSSDNSECTFPFKYTYGVNAWKHWVKTRQLDEDLLVLDELKSPK
SVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGESYAPDSIYYLCLGIQEYLCGSNRKDNI
FIDPGYQTFEQELNKILRSWQPSILPDGSIFSRVEEDYLWRIKQLGSHSPVALLNTLFYF
NTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRK
HEDDEPVFEQIENTANPSRCPVKMFECYLSKSPQNLNQRMDVFYLQPECSSSTDSPVWYT
STSLDRNTLENMLVRVLLVKDIYDKDNYELDEDTD
Download sequence
Identical sequences M3YPK7
XP_012904275.1.14098 ENSMPUP00000013265 ENSMPUP00000013265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]