SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013553 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013553
Domain Number 1 Region: 249-309
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.98e-19
Family Erythroid transcription factor GATA-1 0.00012
Further Details:      
 
Domain Number 2 Region: 201-247
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000095
Family Erythroid transcription factor GATA-1 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013553   Gene: ENSMPUG00000013656   Transcript: ENSMPUT00000013770
Sequence length 414
Comment pep:novel scaffold:MusPutFur1.0:GL896945.1:10578390:10581178:1 gene:ENSMPUG00000013656 transcript:ENSMPUT00000013770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPGLGALGTSEPLPQFVDPALVSSPPESGVFFSSGPEGLDAAASSTAPSTATAAAAAL
AYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYASWTYSKTGLYPAAAVCPTREDSPPQA
PEDPDGKGGSSFLETLKTERLSPDLLTLGPALPSSIPVPSSAYGGPDFSSTFFSPTGSPL
NPAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP
LIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD
GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEMASGLTLGPPST
AHLYQGLGPVVLSGPVSHLVPFPGPLLGSPTGSFPAGPVPPTTTTTTVVAPLSS
Download sequence
Identical sequences M3YQE4
XP_004755084.1.14098 ENSMPUP00000013553 ENSMPUP00000013553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]