SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013590 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013590
Domain Number 1 Region: 567-631,898-1017
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.2e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0056
Further Details:      
 
Domain Number 2 Region: 7-174
Classification Level Classification E-value
Superfamily RUN domain-like 5.1e-30
Family RUN domain 0.001
Further Details:      
 
Domain Number 3 Region: 994-1116
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013590   Gene: ENSMPUG00000013693   Transcript: ENSMPUT00000013807
Sequence length 1124
Comment pep:known scaffold:MusPutFur1.0:GL897019.1:6412528:6499670:-1 gene:ENSMPUG00000013693 transcript:ENSMPUT00000013807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRRAAGFLRSNKIAALFMKVGKNFPPAE
ELSRKVQDLEQLIESTRNQIQGLQENVRKLPKLPNLSPLAIKHLWIRTALFEKVLDKIVH
YLVENSSKYYEKEALLMDPVDGPILASLLVGPCALEYTKMKTADHFWTDPSADELVQRHR
IHSSHLRQDSPTKRPALCIQKRHSSGSMDDRPSLSARDYVESLHQNSRATLLYGKNNVLV
QPKDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGSMGDLDYEKSVYWDYAMTIRLEEIVY
LHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLLQFLSCLENGLLPHGQLDPPLWSQRG
KGKVFPKLRKRSPQGSAESTSSDKEDDEATDYVFRIIYPGMQSEFVAPDPLGSTVFNSVR
PAWMVVPAGRSVLVVARGGPRARTGWGTAFPRPGLMQQPPIPQDLMDVSVSNLPPLWQPS
PRKSSCSSCSQSGLVDGGSSNGCNHERAPLKLLCDNMKYQILSRAFYGWLAYCRHLSTVR
THLSALVNHMIVSPDSPCDAGCGLTARIWEQYLQDSTSYEEQELLRLIYYGGIQPEIRKA
VWPFLLGHYQFGMTEAERKEVDEQIHACYAQTMAEWLGCEAIVRQRERESHAAALAKCSS
GASLDSHLHQMMHRDSTISNESSQSCSSGRQHVRLQSDSSSGTQVFESVDEVEQVEAEGR
LEEKQPKIPNGSLANGTCSPDSGHPSSHNFSSGLSEHSEPSLSTEDSVMDAQRNTPLARR
PGDSSVDDGQSSEATTSRDEAPREELAVQDSLESDLLANESMDEFMSLTGSMDVALPGKE
GATMERWGGGEVEKHSQMDSEDNLSEEPEMESLFPPLASLAVATSANNEASPVSSSGVTY
SPELLDLYTVNLHRIEKDVQRCDRNYWYFTPANLEKLRNIMCSYIWQHIETGYVQGMCDL
LAPLLVILDDEALAFSCFTELMKRMNQNFPHGGAMDTHFANMRSLIQILDSELFELMHQN
GDYTHFYFCYRWFLLDFKRELIYDDVFSVWETIWAAKHVSSAHYVLFIALALVEVYRDII
LENNMDFTDIIKFFNEMAERHNTKHILKLARDLVYKVQTLIENK
Download sequence
Identical sequences M3YQI1
XP_012918984.1.14098 XP_012918985.1.14098 ENSMPUP00000013590 ENSMPUP00000013590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]