SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013695 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013695
Domain Number 1 Region: 7-31,79-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.58e-22
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 140-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.06e-21
Family Voltage-gated potassium channels 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013695   Gene: ENSMPUG00000013798   Transcript: ENSMPUT00000013912
Sequence length 499
Comment pep:known scaffold:MusPutFur1.0:GL896902.1:8904457:8942245:1 gene:ENSMPUG00000013798 transcript:ENSMPUT00000013912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKSYYTQKLHLLKEFPCLGQEGLDKI
LQVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRQAQITCTAIFIVWGVLVHLVIPPF
VFMVTEEWDYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVTGSTASKDINIFGFLSKKEET
YNDLIKQIGKKAMKTSGAGERVPAPGLGPQGGGLPSLPTSLSPLVVYSKNRVPSLEEVSQ
TLRSKGHVSRPPSEEAGAGPPKEGSPTSEVFINQLDRISEEGEPWDAQDYHPLIFQNVSI
TFANEEAGLSDEETSKSSIEDNLAGEERPQEGTEAEAPLNLGEFPSSDESTFTSTESELS
LPYEQLMNEYIQSDCPRGT
Download sequence
Identical sequences M3YQT6
ENSMPUP00000013695 ENSMPUP00000013695 XP_004740042.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]