SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013796 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013796
Domain Number 1 Region: 246-364
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-17
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 
Domain Number 2 Region: 70-161,198-228
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000011
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013796   Gene: ENSMPUG00000013900   Transcript: ENSMPUT00000014014
Sequence length 655
Comment pep:novel scaffold:MusPutFur1.0:GL897284.1:78387:85669:1 gene:ENSMPUG00000013900 transcript:ENSMPUT00000014014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNNHCVPQAPRRLRASFSRKPSLKGNREDGARKLAGLLGTEAGPDLDTTADKIFYYIPG
PDLRGLESQPENLEQPFLSVFKKGRRRVPVRDLGKVVHYAKVQLRFQHSQDVSDCYLELF
HSYLYFQARGSKGLAFQGLLPLMELSVCPLEGSREHAFQITGVWGAWTVGRGYPEPAGGQ
WSRMVPAGPAHSPPLPPGPLPAPLHVLCPSQAELGHWLYHLEKQIALVRGPQLCHSVSLQ
GSPEGELPWTLQRRLIRLRAASGHRTAGSAVCASRVKLQHLPSQEQQDRLLVLYPSSLAI
FSEEAEGLCFKGELPLSTIHVNLEEKEKQIRSFLIEGPLINTIRVLCASYEDYSHWLLCL
QTISPRAGGAPSAGLPGLWGSTQVTGGGRGSLSSDGRTSWDSGCPAPPSTHTSHSLPESS
VPPTTGCPARPVPDQADPGRTSTRRQRAELRRSSSSRSPRSEARTEEPSLATSLYLDLTK
LSRQSLEDNPEAPDHSLKTPHSPLYADPYTPPATSYHKITDVQGLDEFLSAAQSSLGPES
SSPFPSVPVSVPVSGPSSGLSGPHLLSKKGALQPRASQRHRGSVKGQGPLPPDSPQHVSS
STHPCREVSPDPLPPPSGGHPPKSYGNFRDNASSPSHKRWPRGGPEPGGGLVQWI
Download sequence
Identical sequences M3YR37
ENSMPUP00000013796 ENSMPUP00000013796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]