SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013828 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013828
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-36
Family DEATH effector domain, DED 0.000000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013828   Gene: ENSMPUG00000013933   Transcript: ENSMPUT00000014048
Sequence length 131
Comment pep:known scaffold:MusPutFur1.0:GL897121.1:1953422:1955064:1 gene:ENSMPUG00000013933 transcript:ENSMPUT00000014048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMAEYGTLLQDLTDNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDN
LSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEEELDTKLTRIPSAKKYKDIIRQPSEEE
IIKLAPPPKKA
Download sequence
Identical sequences M3YR69
ENSMPUP00000013828 ENSMPUP00000013828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]