SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013991 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013991
Domain Number 1 Region: 478-612,839-1018
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.58e-53
Family Diacylglycerol kinase-like 0.02
Further Details:      
 
Domain Number 2 Region: 196-324
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-23
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 
Domain Number 3 Region: 381-442
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00055
Further Details:      
 
Domain Number 4 Region: 310-370
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000538
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013991   Gene: ENSMPUG00000014099   Transcript: ENSMPUT00000014214
Sequence length 1250
Comment pep:novel scaffold:MusPutFur1.0:GL896945.1:11630912:11797688:-1 gene:ENSMPUG00000014099 transcript:ENSMPUT00000014214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGAAAAQGTAPPQDGEQPAESPEPPPPWPPPRPPPSPPRAPALLHAPSPEPAPQLGPE
PAPEPCPKATREPATEFDTETVSEPNTEPAPGLAPEPATELDKEPTSEPAREPAPEPASE
PATEPATEPASEPTPVPAAEPAPKPVLEPAPEPAIESCPEPAPKSRTEPSPAPRLLQCPV
VAPERGLKTSSSPRTPVLFSSIKKILKEGPLLKNCNSFKRWKLRYFLVRGQRLCFAHHPT
FARFETIDLSQVALAESSCRNLCHSFCVITPQRKVTLAAPNRKDMEEWINVIKTVQQGEI
RKIPAAENNPFLTGMHYWYSSHSSRTQHCNVCRESIPALSRNVIICEVCKVKSHKLCALR
ASKDCKWNTLSITDDLFMPADEVTMPHQWVEGNISVSSQCAVCHENCGSYQRLQDFRCLW
CNSTVHDDCRGRFSKECWFGSHRTSVIPPTALSDPKGDGQLVVSSDFWNLNWSSACSCPL
LIFINSKSGDHQGIVFLRKFKQYLNPSQVFDLSKGGPEAGLCMFKNFSRFRIVVCGGDGS
VSWVLSLIDAFELHEKCQLAVIPLGTGNDLARVLGWGAFWNKNKSPITILNRVEQASVRI
LDRWSVMIRETPRQTPLLRGQVEMDVPRFEAAAIQHLESATTELNKILKAKYPTEMIIAT
RFLCSAVEDFVVDIVKAWSQIKQNNTAIESVILKSDIMYDKLSVLIDILAEEAAVEKSTT
VYADDAKADGKPFIPQIDHIAKCKLELATKAQNLQKSLKLIIFQVEQVLDEQSRQTISVK
NFTSTFSLEDDSEDIRQMSPRHRSRLGTLSSISSLKSEDLDNLNLEHLHFTPETIRFKER
CVMNNYFGIGLDAKISLEFNTRRDEHPGQYNSRFKNKMWYGLLGSKELFHRSYRKLEERV
HLECDGEAISLPNLQGIVVLNITSYAGGVNFWGSSTATAEYEPPAIDDGKLEVVAIFGSV
QMAMSRIINLHHHRIAQCHEVMITIDGEEGIPVQVDGEAWIQRPGLIKIRYKNAAQMLTR
DRDFENSMKMWECKHGEIQAASQPHLDSQESQDSLSDEEYAQMQHLARLAENLISRLTDL
SKVHQHVSVLMDSVNASANILNDIFYSQDSGNEAGAASCIPNETLSRNDAVDVTFSLKGL
YDDTKAFLDENLLRNAEDEATLQTALETMNKELEKLSEIDWMNSILVPEEKSSDTDSRST
RMKVKFPKLGKKKLEEEDKPKSGQGVQGFFGRLWHHRSHEDKAKDDDPPT
Download sequence
Identical sequences M3YRN1
XP_004755182.1.14098 ENSMPUP00000013991 ENSMPUP00000013991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]