SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014026 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014026
Domain Number 1 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 69-129
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.19e-22
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.27e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 270-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 462-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.26e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 2-40
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0000192
Family SCAN domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014026   Gene: ENSMPUG00000014134   Transcript: ENSMPUT00000014249
Sequence length 527
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:8480489:8493803:-1 gene:ENSMPUG00000014134 transcript:ENSMPUT00000014249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQLLITLPTEASTWVKLRHPKKAKEMAPLWEDVTKMFEGEALLSQDADETQEESLKDE
VTSGSRAAESQELLTFKDISVDFTQEEWGQLPLAHRNLYREVMLENYGNLVSVGYQLSKP
SVISQLEKGQEPWMTEKEGPEDPSSGETKTDSRTKRETDASTAKNSILQEQFYHGIMMEG
FLRDDGIYSTLRKVSKYAGDLESHQETHGRDGRQAILTHKKSGQETNKFGENIVSSNVII
EQRHRKCDTPRKRNKYKLDLINHPSYIRTKTYECNICEKNFKQPIHLTEHMRIHTGEKPF
RCKECGRAFSQSASLTTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCDK
CQKAFSQNISLIQHLRTHSGEKPFTCNECGKTFRQVRHLSEHIRIHTGEKPYACTACCKT
FSHRAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECSRCGKAYRHD
SSFKKHQRHHTGEKPYECNECGKAFSYNSSLSRHHEIHRRNAFRNNV
Download sequence
Identical sequences M3YRR6
ENSMPUP00000014026 ENSMPUP00000014026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]