SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014520 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014520
Domain Number 1 Region: 5375-5533
Classification Level Classification E-value
Superfamily SET domain 9.42e-49
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 1374-1434
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000509
Family PHD domain 0.0039
Further Details:      
 
Domain Number 3 Region: 274-328
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000117
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1449-1517
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000113
Family PHD domain 0.025
Further Details:      
 
Domain Number 5 Region: 1328-1382
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000117
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 226-279
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000104
Family PHD domain 0.01
Further Details:      
 
Domain Number 7 Region: 1976-2026
Classification Level Classification E-value
Superfamily HMG-box 0.00000223
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014520   Gene: ENSMPUG00000014629   Transcript: ENSMPUT00000014753
Sequence length 5533
Comment pep:novel scaffold:MusPutFur1.0:GL897186.1:1025483:1057083:1 gene:ENSMPUG00000014629 transcript:ENSMPUT00000014753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQKPPGEDKDSEPAADGPVASEESGTTEADLPNPHVGEVSVPNSGGPRLQDPPQDCSG
GPARRCALCNCGEPSLHGQRELRRFELPFDWPQCPVVSPGGNPGPNEAALPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCASWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRFGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAHLAPEEARCAVCEGPGEL
CDLFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGY
HTFCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRCHKAQGGQLI
GSVAEQHRPTCSRFSPSEPGDTPTDEPEALYVTCQGQPKGGHVTSMQPKEPGPLHCEAKP
LGRAGAQLEPRLEGPLSEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEESPLSP
PPEEESPFSPPEESPPSPPLETPLSPPPEASPLSPPFEESPLSPPPEELPTSPPPEASRL
SPPPEESPMSPPPEESPMSPPPEASRLFPPFEESPLSPPPEESPLSPPPEASRLSPPPED
SPMSPPPEDSPMSPPPEVSCLSSLPEVSRLSPPPEESPLSPPPEEAPTSPPPEASRLFPP
PEDSPTSPPPDDSPASPPPEDLLVTLPLEESSLLPLPEEPRLCPQPEEPCLSPRPEEPHL
SPQPEEPHLSPRPEEPHLSPRPEEPRLSPVLEEPCLSPAPEEEPRLSPRPEKPCLSPAPE
ELHLSPGPEEPCLSPRPEEPCLSPRPEETKEPRLSPRPEEPPEEPGLCPAPEESPLFLPP
GEPPLSPLLGEPTLSEPGEPPLSPLPEELQVSPSGEPSLSPQLMPPDPLPPPLSPIITAV
APPALSPLGELEYPFGAKGDSDPESPLAAPILETPISPPPEANCTDPEPVPPMILPPSPG
SPVGPASPILMEPLPSRCSPLLQHSPPPPNSPPSQCSLPALPLSIPSPLSPMEKAVEVSE
EAEPHEMETEKVPEPECPALEPSPTSPLPSPMGNLSCPAPSPAPPLDDFSGLGEDTAPLD
GTDTPGSQPEAGQTPGSLASELKGSPVLLDPEELAPVTPMEVYGPEGKQAGQGSPCEEQE
EPRIPVAPTPPTLIKSDIVNEISNLSQGDASASFPGSEPLLGSPDPEGGGSLSMELGVST
DVSPARDEGSLRLCTDSLPETDDSLLCDAGTAIGGGKAEGDKGRRRSSPARSRIKQGRSS
SFPGRRRPRGGAHGGRGRGRARLKSTTSSIETLVVADIDSSPSKEEEDDDDDTMQNTVVL
FSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVE
CIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPG
FHCEWQNSYTHCGPCASLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQA
ADEGFDCVSCQPYVVKPAAPVAPPELVPMKVKEPEPQYFRFEGVWLTETGMAVLRNLTMS
PLHKRRQRRGRLGLPGEAGLEGSEPSDALGPDDKKDGDLDTDELLKGEGGVEHMECEMKL
EGPISPDVEPGREETEESKKRKRKPYRPGIGGFMVRQRKSHTRVKKGPAAQAEVLSGDGQ
PDEVMPVDLPVEGPVDQNLADGDEKKKQQRRGRKKSKLEDMFPAYLQEAFFGKELLDLSR
KALFAVGVGRPSFGLGTPKAKGDGGSDRKELPTSQKGDDGPDVADEESRGPEGKADTPGP
EDGGIKASPVPSDPEKPGTPGEGMLSSDLDRIPTEELPKMESKDLQQLFKDVLGSEREQN
LGCGTPGPDGSRTPLQRPFLQGGLPLGNLPSSSPMDSYPGLCQSPFLDSRERGGFFSPEP
GEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLYANI
NFPNLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHRINKVQKQAESQINK
QTKVGDMARKTDRPALHLRIPPQPGALGSPPPAAAPTIFIGSPTTPAGLSTSADGFLKPP
AGTVPGPDSPGELFLKLPPQVPAQVPSQDPFGLAPAYALEPRFPTAPPTYPPYPSPTGAP
AQPLTLGSSSRPGTGQPGEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGIGGG
KATEPLLSPPPFGESRKALEVKKEELGASSPSYGPPNLGFVDSPSSGPHLGSLELKAPDV
FKAPLTPRASQVEPQSPGLGLRPQEPPPAQALAPSSPSHSDIYRPGPYPDPYAQPPLTPR
PQPPPPESCCGLPPRSLPSDPFSRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQS
PDPYSRPPSRPQSRDPFAPLHKPPRPQPPEVAFKAGPLAHTPLGAGGFPAALPSGPAGEL
HAKVPSGQPPNFVRSPGTGAFVGTPSPMRFTFPQAVGEPSLKPPVPQPGLPPPHGINSHF
GPGPTLGKPQSTNYAVATGNFHPSGSPLGSSSGSTGEGFGLSPLRPPSVLPPPAPDGSLP
YLSHGASQRAGITSPVDKREDPGAGMGSSLAAPELPGTQDPGMSSLSQTELEKQRQRQRL
RELLIRQQIQRNTLRQEKETAAAAAGVVGPPGSWGAEPSSPAFEQLSRGQTPFTGTQDKS
NLVGLPPSKLGGPILGPGAFPSDDRLSRPPPPATPSSMDVNNRQLVGGSQAFYQRAPYPG
SLPLQQQQQQQQQQQQQLWQQQQQQQATAATSMRLAMSTRFPSTPGPELGRQALGSSLAG
IPTRLPGPGEPVPGPAGPAQFIELRHNVQKGLGPGGAPFPGQGPPQRPRFYPVNEDSHRM
APEGLRGLAVSGLPPQKPSVPPIPELSNSLHPMPHTKGPSLPTGLELVSRPPSSTELGRP
PPLALEAGKLPCEDPELDDDFDAHKALEDDEELAHLGLGVDVAKGDDELGTLENLETNDP
HLDDLLNGDEFDLLAYTDPELDTGDKKDIFNEHLRLVESANEKAEREALLRGVEPVPLGP
EERPPPATDACEPRLASGLPEVKPKVEEGGRHPSPCQFAITTPKVEPAPATTSLGLGLKP
AQSVMGIRDTRMGTGPFSSSGHTTEKGPFGATGGPPAHLLTPSPLSGPGGSSLLEKFELE
SEALTLPSGHAASGDELDKMESSLVASELPLLIEDLLEHEKKELQKKQQLSAQLQPAQQQ
QQQHSLLSTPGPAQTMSLPHEGSSPSLAGPQQQLALGLGGSRQPGLAQPLMPTQAPAHAL
QQRLAPSMAMVSSQGHMLSGQHGGQAGLVPQQSSQPVLAQKPMGTMPPSMCMKPQQLAMQ
QQLANSFFPDTDLDKFAAEDIIDPIAKAKMVALKGIKKVMAQGSIGVAPGMNRQQVSLLA
QRLSGGPGSDLQNHVAVGSGQERSAGDPSQPRPNPPTFAQGVINEADQRQYEEWLFHTQQ
LLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLD
QVRKQQKEHTNLMAEYRSKQQQQQQQQQQHSAVLALSPSQSPRLLTKLPGQLLPGHGLQP
PQGPPGGQAAGLRLPPGGMTLPGQPGGPFLNTSLAQQQQQQQQHSGGAGPLAGPSGGFFP
GNLALRGLGPDSRLLQERQLQLQQQRMQLAQKLQQQQQQQQHLLGQVAVQQQQQQSLGVQ
ANQALGPKPQGLLPPSSHPGLLVQQLSPQPPQGPQGMLGPAQVAVLQQQQQHPGALGPQG
PHRQVLLTQSRVLSSPQLAQQGQGLMGHRLVTAQQHQQQHQQQGSMAGLSHLQQGLMPHG
GQPKLSTQPMATLQQQQQQLQQQQQQQQHLQQQQQQQLQQQQQQQQQQQQQQQQQQHLQQ
QQHQQQQLQQQQQQQHQQQQHQQQQLQQQQQQLQQQQHQQQQLQQQQQQQLQQFQQQQQQ
QQMGLLNQSRTLLSPPQPPPPQQQVPLGPGMPAKPAQHFSSPGALGAAVLTGKEQSMVDT
AVPPEAVEGPSTHPGAPLALGAVPESAATEPGEVKPSLSGDSQLLLIPPQAQPQPGPAQL
QPPLRLPGPQQQQVNLLHSAGVGSHGPVGSGSSSETSSMPHLLAQSSVPLGEQPGTMTQN
LLGSQQPLGLERPMQNNAGPQPAKAGSGLPPGPGLPGPGVMPTMGQLRAQLQGVLAKNPQ
LRHLSPQQQQQLQALLVQRQLQQSQTVRQAPPYQEPGAQPSPLQGLLGRQPQLGGFSGSQ
TGPLQELGAGLRPQGPPRLPAPQGALAAGPVLGPVHPTPPPSSPQEPKRPSSQPPGASPL
VPSQLPSEAQLPPTQPGTPKPQGPSLELPPGRVSPAASQLADTFFGKGLGPWDPPDNLVE
ARKPDQSSLVPGHLEQVNGQAVTEPPHLSIKQEPREEPCALGAQAVKREANGEPIGAPGT
SNHLLLAGPRSEAGHLLLQKLLRAKNVQLSTGQGPEGLRAEINGHIDSKLAGLEQKLQGT
PSNKEDTTARKPVTPKPKRVQKASDRLVSSRKKLRKEDGVRASEALLKQLKQELSLLPLT
EPTITANFSLFAPFGSGCPVNGQCQLRGAFGSGALPTGPDYYSQLLTKNNLSNPPTPPSS
LPPTPPPSVQQKMVNGVTPSEELGEHPKDAASARDTEGTLRDASEVKSLDLLAALPTPPH
NQTEDVRMESDEDSDSPDSIVPASSPESILGEEAPRFPQLGSGRWEQEDRALSPVIPIIP
RASIPVFPDTKPYGALDPEAPGKLPATTWEKGKGSEVSVMLTVSAAAAKNLNGVMVAVAE
LLSMKIPNSYEVLFPESPARPGTEPKKGEAEGPVGGKEKGLGGKSPEAGPDWLKQFDAVL
PGYTLKSQLDILSLLKQESPAPEPAAQHSYTCNVSNLDVRQLSAPPPEEPSPPPSPLAPS
PASPPAEPLVELPTEPLAEPPVPSPLPLASSPESARPKPRARPPEEGEDSRPPRLKKWKG
VRWKRLRLLLTIQKGSGRQEDEREVAEFMEQLGTALRPDKVPRDMRRCCFCHEEGDGATD
GPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSC
NRMRCPNVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQ
IASIIQRGERLHMFRVGGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYWSLRTNNR
RCCYRCSIGENNGRPEFIVKVMEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLF
PEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLMELPLMINPTGCARSEPK
ILTHYKRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARS
RIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDAT
LTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIP
CHCGAWNCRKWMN
Download sequence
Identical sequences M3YT60
ENSMPUP00000014520 ENSMPUP00000014520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]