SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014527 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014527
Domain Number 1 Region: 367-445
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.09e-24
Family Intermediate filament protein, coiled coil region 0.00087
Further Details:      
 
Domain Number 2 Region: 134-169
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000157
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014527
Domain Number - Region: 187-280
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00115
Family Myosin rod fragments 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014527   Gene: ENSMPUG00000014636   Transcript: ENSMPUT00000014760
Sequence length 495
Comment pep:novel scaffold:MusPutFur1.0:GL897006.1:283560:289518:1 gene:ENSMPUG00000014636 transcript:ENSMPUT00000014760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRYSSSKQYSSSRSGGGGGGGGGSSFRISSSKGSIGGGFSSGGFSGGSFSRGSSSGGC
FGGSSGGYGGLGGGFGGGNFGGGYGSSSFGGGCGGGSFGGGSFGGGGFGGGGFGGGSFGG
YGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSSQ
REPRDYSKYYQTIEELKNQILSLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVDA
DINGLRRVLDELTLAKADLEMQIESLTEELAYLKKNHEEEMKDLHNVSTGDVNVEMNAAP
GVDLTELLNNMRNQYEQLAEQNRKDAEAWFNEKSKELTTEINSNIEQMSSHKSEITELRR
TVQGLEIELQSQLALKQSLESSLAETEGRYCVQLSQIQAQISSLEEQLQQIRAETECQNA
EYQQLLDIKIRLENEIQTYRSLLEGEGSSSGGGGYGGGRGGGSSGGGYGGGSSGGGHKSS
SSGSVGESSSKGPRY
Download sequence
Identical sequences M3YT67
ENSMPUP00000014527 ENSMPUP00000014527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]