SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014579 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014579
Domain Number 1 Region: 2758-2862
Classification Level Classification E-value
Superfamily Bromodomain 5.63e-37
Family Bromodomain 0.0000445
Further Details:      
 
Domain Number 2 Region: 2632-2693
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.55e-16
Family PHD domain 0.0011
Further Details:      
 
Domain Number 3 Region: 2695-2749
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.84e-16
Family PHD domain 0.00093
Further Details:      
 
Domain Number 4 Region: 251-307
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000179
Family PHD domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014579
Domain Number - Region: 2578-2588
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00471
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014579   Gene: ENSMPUG00000014688   Transcript: ENSMPUT00000014812
Sequence length 2877
Comment pep:known scaffold:MusPutFur1.0:GL896922.1:13758184:13920473:1 gene:ENSMPUG00000014688 transcript:ENSMPUT00000014812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSEEEEEEEEEDGDAEETQDSEDDEEDEMEEDDDDSDYPEEMEDDDDDASYCTESSFRS
HSTYSSTPGRRKPRVHRPRSPILEEKDIPPLEFPKSSEDLMVPNEHIMNVIAIYEVLRNF
GTVLRLSPFRFEDFCAALVSQEQCTLMAEMHVVLLKAVLREEDTSNTTFGPADLKDSVNS
TLYFIDGMTWPEVLRVYCESDKEYHHVLPYQEAEDYPYGPVENKIKVLQFLVDQFLTTNI
AREELMSEGVIQYDDHCRVCHKLGDLLCCETCSAVYHLECVKPPLEEVPEDEWQCEVCVA
HKVPGVTDCVAEIQKNKPYIRHEPIGYDRSRRKYWFLNRRLIIEEDTENENEKKIWYYST
KVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNKARGSNKSFLAAANEEI
LESIRAKKGDIDIVKSPEEVEKDKNETENNSSKDVEKSREEFEDQSLEKDSDDKTADDDP
EQGKSEEPTEVGDKGNSVSANLGDNTTNASSEETSPSEGRSPVGCLSETHDSSNMAEKKV
ASELPQDVPEEPNKTCDSSNTSATTTSIQPNLENSNSSSELNSSQSESAKAADEPENGER
ESHTPVSIQEEIGDFKSEKSNGEISESSGAGRGASGSTRIITRLRNPDSKLSQLKSQQVA
AAAHEANKLFKEGKEVLVVNSQGEISRLSTKKEVVMKGNINNYFKLGQEGKYRVYHNQYS
TNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKVLTISTLRLTITQLENN
IPSSFLHPNWASHRANWIKAVQMCSKPREFALALAILECAVKPVVMLPIWRESLGHTRLH
RMTSIEREEKEKVKKKEKKQEEEETMQQATWVKYTFPVKHQVWKQKGEEYRVTGYGGWSW
ISKTHVYRFVPKLPGNTNVNYRKSLEGTKNNADENMDESDRRKSPRSPKKIKTEPDSEKG
EVKDSDAAKGADQSEMDVSKITEKKDQDVQEILDSDNEKPFKEEPMEIDDDVKTEPHINC
HEGSQVDVVNVSEGFHLRTSYKKKIKSSKLDGLLERRIKQFTLEEKQRLEKMKLEGGNKG
IGKTSASSLKSLSESPVTMKAKEGCQSDSLRQEQSPNASNGKSEDVIRGCSQSDSSVLEI
GDPDHTTERLYPKDQTLDDVSIQSPDTNCQKQNSVGNDIDESLSEPTSQGQEPSKIKTRG
SDFLIGDSKLACTDEIGTLIYKNKKPLIQEDNDTIVSPSQSPSLPSVPKSTDDKDLSSLS
KAVDFEGKLGCVSEYNSTLENSSDTMSIQDSSEEDMIVQNSNENLSEQFITQEQGIEGLE
TLKREFVPDKSPGNYDKRPQGKVTEANGRKPSQEQKLEERTVNKCIDQVNLKSSTDKKNN
ENRESEKKGQKASTFQINGKDNKPKTYLKGECLKDISESKVVSGDIEPKLNNINKLIPEN
DIKPLTAKESAVKPFMNGDVIMEDFNEKNNLETNSCLQRSSDGEGDYQDGLETLPSTKEC
ESAHATVPSLSGPESSSGNQVEDMEVETSEVKKVTPSPVTSGEESNLSNDFVDENGLPAH
KDENVNGESKRKTVITEVTTMTSTVATESKTVIKVAKGDKQTVVSSTENCAKSTVKTTTT
TVTKLSTPSTGSSVDIISVKEQSKTVVTTTVTDSLTTAGGTLVTSMTVSKEYSTRDKVKL
MKFSRPKKTRSGTALPSYRKFITKSSKKSIFVLPNDDLKKLARKGGIREVPYFNYNAKPA
LDIWPYPSPRPTFGITWRYRLQTVKSLAGVSLMLRLLWASLRWDDMAAKAPPGGGTTRTE
TSETEITTTEIIKRRDVGPYGIRSEYCIRKIICPIGVPEAPKETPTPQRKGLRSSALRPK
RPETPKQTGPVIIETWVAEEELELWEIRAFAERVEKEKAQAVEQQAKKRLEQQKPTVIAA
STTSPTNSTTSTISPAQKVMVAPISGSVTTGTKMVLTTKVGSPATVTFQQNKNFHQTFAT
WVKQGQSNSATSTAATSATTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPA
TQGGVVQVQQKVLGIIPSSTGTSQQTFTSFQPRTATVTIRPNTSGSGGTTSTSQVITGPQ
IRPGMTVIRTPLQQSALGKAIIRTPVMVQPGAPQQVVTQIIRGQPVSTAISAPSAVSSTP
AQKGLTSGTPSTNLQSSASQPPRPQQGQVKLTMAQLTQLTQGHGGNQGLTVVIQGQGQTT
GQLQLIPQGVTILPGPGQQLMQAAMPNGTVQRFLFTPLATTATAASTTTTTVSTTAAGTS
EQKQSKLSPPTQVQQAKTVSPAQSSSVSPPEAQPQTAQPSAQPQPQTQPPSPAQPEVQTQ
PEVQTQTTVASHVPPEAQPTQAQSSKPQAAVQCQPQSHVQGQSPARVQSPPQTRIRPSTP
SQVSPGQQSQVQTTTSQPIPIQPHTSLPIPSQGQPQSQPQVVMKHNAVIEHLKQKKTMTP
AEREENQRMIVCNQVMKYILDKIDKEEKQAAKKRKREESVEQKRSKQNATKLSALLFKHK
EQLKAEILKKRALLDKDLQIEVQEELKRDLKIKKEKDMVQATAVAATSPAAPPAPPAPPP
SPPPPPPPQHTGPLATATATATLPVASQKRKREEERDSSSKSKKKKMISTTSKETKKDTK
LYCICKTPYDESKFYIGCDLCTNWYHGECVGITEKEAKKMDVYICNDCKRAQEGSSEELY
CICRTPYDESQFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLT
EKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKL
TEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKASRSHNNKLQSTAS
Download sequence
Identical sequences M3YTB9
ENSMPUP00000014579 ENSMPUP00000014579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]