SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014965 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014965
Domain Number 1 Region: 366-571
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.54e-59
Family Nucleotide and nucleoside kinases 0.00012
Further Details:      
 
Domain Number 2 Region: 204-351
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-30
Family SH3-domain 0.00081
Further Details:      
 
Domain Number 3 Region: 130-221
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-21
Family PDZ domain 0.00087
Further Details:      
 
Domain Number 4 Region: 72-122
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000459
Family L27 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014965   Gene: ENSMPUG00000015076   Transcript: ENSMPUT00000015202
Sequence length 576
Comment pep:known scaffold:MusPutFur1.0:GL897201.1:956769:1244381:1 gene:ENSMPUG00000015076 transcript:ENSMPUT00000015202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALSTGSGSDAGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYY
EKQNPVPILHGAAVLADDLAEELQNKPLNSEIRELLKLLSKPNVKALLSVHDTVAQKNYD
PVLPPMPDDIDDEEDSVKIIRLVKNREPLGATIKKDEQTGAIVVARIMRGGAADRSGLIH
VGDELREVNGIPVEDKRPEEIIQILAQSQGAITFKIIPSIKEETPSKEGKMFIKALFDYD
PNEDKAIPCKEAGLSFKKGDILQIMSQDDATWWQAKHADDANPRAGLIPSKHFQERRLAL
RRPEILVQPLKVSNRKSSGFRRSFRLSRKDKKTNKSMYECKKSDQYDTADVPTYEEVTPY
RRQTNEKYRLVVLVGPVGVGLNELKRKLLISDTQHYGVTVPHTTRARRSQESDGVEYIFI
SKHLFETDVQNNKFIEYGEYKNNYYGTSIDSVRSVLAKNKVCLLDVQPHTVKHLRTLEFK
PYVIFIKPPSIERLRETRKNAKIISSRDDQGAAKPFTEEDFQEMIKSAQIMENQYGHLFD
KIIVNDDLTVAFNELKTTFDKLETEAHWVPVSWLHS
Download sequence
Identical sequences M3YUF5
XP_004779408.1.14098 XP_004779409.1.14098 ENSMPUP00000014965 ENSMPUP00000014965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]