SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015015 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015015
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-38
Family SCAN domain 0.0000382
Further Details:      
 
Domain Number 2 Region: 573-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.86e-16
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 207-262
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000301
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 
Domain Number 4 Region: 411-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000232
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 371-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000404
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015015   Gene: ENSMPUG00000015125   Transcript: ENSMPUT00000015252
Sequence length 622
Comment pep:novel scaffold:MusPutFur1.0:GL896925.1:13019702:13046479:-1 gene:ENSMPUG00000015125 transcript:ENSMPUT00000015252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGPGSQDREGLLIVKLEEDCAWSQEPPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHEWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRLQVTNHRRGTEVLLEETLPLETARESPSFKLEPMETERSPGPRLQELLGPSPK
RDPQAVKERVLNRDWVSGSGYRVVLTGPQLPESLEDVAMYISQEEWGHQDPSKRALSRDT
VQESYENVDSLESQVPNQEALSTQVEQGGKPWDPSVQTCKEGPSPSSPAPGEEKFENQEE
SAQSVFPESIHPQALLPGQARGEVPWSPEQERPRDRAEGHWEPPPEEGMEPSLVGATSCR
ELGRPKELQLKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVGCGEIFAGNPHFLSL
HRTHLGEEAHKCLECGKSFSQNTHLTRHQRNPGTHKAEKKLFECLTCGKSFRQGISLRPT
QRVLLGAGVLCPGPPNLFLNKSAFIRKNRVNTLSLSLKCPRSCSQESKLVTRQARKGRER
RLSFSNPGHTVNSPLPFLKYNLCRDLTFKILLICILCGKSFSQNSHLIKHRRTHTGEQPY
TCSVCRRNFSRRSSLLRHQKLH
Download sequence
Identical sequences M3YUK5
ENSMPUP00000015015 ENSMPUP00000015015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]