SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015241 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015241
Domain Number 1 Region: 543-755
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.000074
Further Details:      
 
Domain Number 2 Region: 93-364
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.56e-34
Family FCH domain 0.054
Further Details:      
 
Domain Number 3 Region: 483-538
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000959
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015241   Gene: ENSMPUG00000015351   Transcript: ENSMPUT00000015480
Sequence length 969
Comment pep:novel scaffold:MusPutFur1.0:GL896974.1:5035607:5044809:1 gene:ENSMPUG00000015351 transcript:ENSMPUT00000015480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAEPGLPPAPESRKRYSDIFRSLDNLEISLGNVTLEMLPGDPVLSGDPESDKTPTANE
TSETSIWSRPSTEGPAPLTGEELDLRLIRTTGGVDAALEYAKTWSRYAKELLAWTEKRAS
LELEFAKSIMKIAEAGKVSIHQQNHMPLQYIYTLFLEHDLSLGALAMETVAQQKRDYYQP
LAAKRTEIEKWRKEFKEQWTKEQKRMNDAVQALRRAQLQYVQRSEDLWVRSQASPEDPAP
QASPGPSKQQERRRRSREEAQAKVQEAMALYQMCVREANARQQDLEAAKQRIVSHVRKLV
LQGDEVLRRVTLGLFKLRGAQAERGPRAFSALAECCEPFEPGQRYQEFVRVLQPEAPPPP
PPAFSFQEFVPAAHSSPLDTRKKISCPPPPRLDESASEAGPWEDAGTGWQGTPGRTPGGD
ADSVGGGSESRSLDSPTSSPGSGTRRLVKVSSIGTESSDDFEERDPDLVDGLENGLGSPF
RKWTLSNAAQTHRLRRLRGPAKCRECDAFMVSGTECEECFLTCHKRCLETLLILCGHRRL
PARTPLFGVDFLQLPRDFPEEVPFVITKCTAEIEQRALGVQGIYRVSGSRVRVERLCQAF
ENGRALVDMSGNSPHDVSSVLKRFLQELTDPVVPFHLYDAFISLAKTLHADPGHDPGTPS
PSPEVIRSLKTLLVQLPDSNYSTLRHLVAHLFRVAAQFEENKMSANNLGIVFGPTLLRPP
DGPGTAGAGPVTCLLDSGHQAQLVEFLIVYYEQIFGMDDLPVATEPLPQDPSPAPGPLLN
NNLQPPSSDLAPDPLPPVLASDPDPDPEPHSTLEKHPEATPPEIPTPQSDQRDMVEDTRE
EGGEVSSQGPEDSLLGTQSRGHFSRQPVKYPRGGVRPVTHQLSSLAQVASKLSEETPVAS
VTRGSLRRRGPGPVSSSSPEGSPLRRTALPKHFEITQETARLLSKLHNEAVPKATCCPDP
QPEEVEDHL
Download sequence
Identical sequences M3YV81
ENSMPUP00000015241 ENSMPUP00000015241 XP_004760904.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]