SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015278 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015278
Domain Number 1 Region: 459-637
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-50
Family SPRY domain 0.00079
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 1.7e-19
Family RING finger domain, C3HC4 0.0083
Further Details:      
 
Domain Number 3 Region: 149-209
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000565
Family B-box zinc-binding domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015278   Gene: ENSMPUG00000015388   Transcript: ENSMPUT00000015517
Sequence length 653
Comment pep:novel scaffold:MusPutFur1.0:GL896917.1:15291830:15313376:1 gene:ENSMPUG00000015388 transcript:ENSMPUT00000015517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELVPLAEELSCSICLEPFKEPVTTPCGHNFCGLCLDETWAVQGSPYLCPQCRASYHAR
PQLRKNTVLCAVVEQFLQAEEARATPPPPDDWKLPTRAATPSPAGPVACDHCLKEAAVKT
CLVCMASFCREHLQPHLDSPAFRDHQLQPPVQDLMRRKCPRHNRLRELFCPQHDECICHI
CLVEHKACSPVPLSQASADLETKLKHKLTVIYSQINGASRALEDVRARQHDVRETTNRRM
EQLRQEYMEIKALIDAAEVTSTRKIKEEEKRVNTKFDNIYQILLKKRSEIQNLKEAVELA
LTKGDEFEFLEKGLKLQGVSTKPVYVPKVELNQELIRGVCQGTSDLKDELKRYIRQSQDK
KPEEPTSSGNPGEHGPAPTHKPTHSAKKGPKEEKKAKKPPPASAFKMPTLGALATKMPTF
GAQGESVDLEGIGKAPTAQPNAAAVKAKVLETFLAKSRPELLEYAVKFSLDYNTAHNKVA
LSENYTVASVAESPLNYQPHPKRFMYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGVCYG
SMPRQGPESRLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFF
AVSDKVHLMYKFKVDFTEALYPAFWVFSAGAMLSICSYKESAAAACSSPGDVA
Download sequence
Identical sequences M3YVB8
ENSMPUP00000015278 XP_012909123.1.14098 ENSMPUP00000015278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]