SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015384 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015384
Domain Number 1 Region: 144-232
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-25
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 2 Region: 6-93
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-25
Family PDZ domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015384   Gene: ENSMPUG00000015496   Transcript: ENSMPUT00000015625
Sequence length 337
Comment pep:novel scaffold:MusPutFur1.0:GL896925.1:13987709:14000096:-1 gene:ENSMPUG00000015496 transcript:ENSMPUT00000015625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVMPDPRGPGMCRXVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVN
GVNVEGETHHQVVQRIKAVEGQTRLLVVDKETDEELRRRQLTCTEEMAHRGLPPAHDPWE
PKPDWARASSLGSEAGQKDVGGPPRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVD
PGSPAAHSGLRAQDRLIEVNGHNIEGLRHAEVVASIKAREDEARLLVVDPETDEYFKRLR
VTPTEEHLEGPLPSPVTNGTSPVQLNGGSACSSRSDLPGLDKDTEDSSTWKRDPFQESGL
HLSPTAAEAKEKARATRVNKRAPQMDWNRKREIFSNF
Download sequence
Identical sequences M3YVM4
ENSMPUP00000015384 ENSMPUP00000015384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]