SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015392 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015392
Domain Number 1 Region: 1862-2020
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.32e-55
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000848
Further Details:      
 
Domain Number 2 Region: 1701-1861
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-55
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000213
Further Details:      
 
Domain Number 3 Region: 1380-1554
Classification Level Classification E-value
Superfamily Cupredoxins 8.36e-48
Family Multidomain cupredoxins 0.0000306
Further Details:      
 
Domain Number 4 Region: 252-436
Classification Level Classification E-value
Superfamily Cupredoxins 3.73e-46
Family Multidomain cupredoxins 0.0000517
Further Details:      
 
Domain Number 5 Region: 443-566
Classification Level Classification E-value
Superfamily Cupredoxins 2.83e-37
Family Multidomain cupredoxins 0.00019
Further Details:      
 
Domain Number 6 Region: 1562-1701
Classification Level Classification E-value
Superfamily Cupredoxins 1.22e-33
Family Multidomain cupredoxins 0.00000124
Further Details:      
 
Domain Number 7 Region: 110-232
Classification Level Classification E-value
Superfamily Cupredoxins 7.16e-32
Family Multidomain cupredoxins 0.00000127
Further Details:      
 
Domain Number 8 Region: 2-101
Classification Level Classification E-value
Superfamily Cupredoxins 9.46e-28
Family Multidomain cupredoxins 0.00000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015392   Gene: ENSMPUG00000015504   Transcript: ENSMPUT00000015633
Sequence length 2021
Comment pep:novel scaffold:MusPutFur1.0:GL896953.1:250575:317165:-1 gene:ENSMPUG00000015504 transcript:ENSMPUT00000015633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVHFKNKADKPVSIHPQGIKYSKFSEGASYSDHTFPVEKMDDAIAPGQEYTYEWKISEG
SGPTHDDPPCLTHIYYSYENLIQDFNSGLIGPLLICKKGALTDNGVQKMFDKQHVLMFAV
FDESKSWSPSSSLMYTVNGYVNGTMPDITVCAHDQVSWHLIGMSSGPELFSIHFNGQVLE
QNHHKISAITLVSATSTTANMTMSPEGKWIISSLVPRHFQAGMQAHIDIKNCAKKTRNPK
KLTRDQRRHMKRWEYFIAAEEVIWDYAPVIPVNMDKKYRSLHLDNFSNQIGKHYKKVVYK
QYQDESFTKRMENDNIKEDGILGPIIRAQVRDTLKIVFKNMASRVYSIYPHGVTFSPHED
DANASLASDNTTMVRAVRPGETHTYKWNILESDEPTEHDAQCLTRPYYSHVDVTRDIASG
LIGLLLICKSRSLDKRGIQRAADIEQQAVFAVFDENKSWYIEDNINKFCENPDKVKRDDP
KFYESNIMSTINGYVPESIPTLGFCYDDTVQWHFCSVGTQDDILTIHFTGHSFIYGKRHE
DTLTLFPMRGESVTVTMDNVGTWMLTTINSNPRNKNLRLRFRDVKCIRDDYEDSYEIIYG
PPASTAMTTRKMRDSSENMGEEVDDDDDYQNSLASWLGIRSFRNSSLNQEEEEFNLTALA
LENNSEFIPPDTALSSNSSSLSNISRFTVYNFAKPQKTLPHSAATMAGRSLGHIGLDKNS
ALNRSTAEHSSPYSEDSVEDPLQPDITEISLLPFDAEGFRGQEHAKHKGSKKGSEHTAKH
RFSQVEFSAQKTGRYLSQGNSSPSRMGSWEDLPSDPLLLKQKNPSKVVNGKWHVVSEKGS
YEIVPDADEDMAVDKLLDSPRNASRTWGENIPLIKKHRKQSGHPRFSGIRNKSLQVKQDR
GNSGLKKIPFFIKTRKKKKEVKFAHHIPLSPRGFHPLRGKANTTFSDRRLDHSLLPHKSD
EASFPTDLNQTFPSVNLSQLASLPDHNHNAPNDTSQMSSPLDLYQAIPPEEYYQAFPIGE
SDQIHSTTDSSHTSPPESGQMLDYDLRKKPFPTDIDQVFPSLEPEAWQATLSADLSQLTI
SPDLDHTTFSPDLSQTTLSPDLSKTTLSSDFDHTAFSPDLIQTTFSPDLSQTNLSPDLSK
TTLSPDFDHTTFSPDLDQATFSPDLDQATFSPDLSQTTLYPDLDQTSFSSDLSHTTLSPD
LSQTPFSPDLDQETLSSDISQTTLFPDLDQMLLYPDLNQATLSPNISQTALPPDLDTSLP
PDLDQTSYTSESTQSLLPPEFGQISSHPDIGQVPSPTLNNTLVPRELNPPVVIGLSANDG
DYIEIIPRQKEESSEEYTAEIDFVAYDDPYQTDTRTDINSSRNPDSIAAWYLRSNSGNRK
YYYIAAEEISWDYSKFAQSEDIDDDPENTIYKKVVFRKYLDSTFTKRDPLGEYEEHLGIL
GPIIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKSSEGKTYEDDSPEWFKEDNAVQPNS
SYTYVWHATTRSGPESPGSACRAWAYYSAVNPEKDIHSGLIGPLLICEKGVLDKSNTPMD
MREFVLLFMIFDEKKSWYYEKKTQSPRPWRLASSEVKNSHEFHAINGMIYNLPGLRMYEQ
EWVRLHLLNMGSSQDIHVVHFHGQTLLENGTRQHQRGVWPLLPGSFKTLEMKASKAGWWL
LDTEVGENQRAGMQTPFLIIDRECKMPMGLSTGIIADSQIKASEHLGYWEPRLARLNNGG
SYNAWITEKPSPELDTKPWIQVDMQREVVLTGIQTQGAKQYLKSYYTTQFSVAYSSDRTN
WQIFKGNSTRNVMYFDGNSDASTIKENRFDPPIVARYIRISPTRFYNRPALRLELLGCEV
NGCSAPLGMENGKIENKQITASSFKKSWWGDYWEPFRARLNAQGRVNAWQAKANNHQQWL
QIDLLKIKKITAIVTQGCKSLSSEMYVKSYSIQYSDQGMEWKPYRQGSSMVAKIFEGNNN
IKGHVKNSFNPPIMSRFIRIIPKTWNQSIALRLELFGCDIY
Download sequence
Identical sequences M3YVN2
XP_012913826.1.14098 ENSMPUP00000015392 ENSMPUP00000015392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]