SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015551 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015551
Domain Number 1 Region: 110-442
Classification Level Classification E-value
Superfamily Subtilisin-like 3.14e-96
Family Subtilases 0.00000000000544
Further Details:      
 
Domain Number 2 Region: 436-575
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-43
Family Proprotein convertase P-domain 0.000000374
Further Details:      
 
Domain Number 3 Region: 30-100
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.17e-24
Family Prohormone convertase 1 pro-domain 0.0034
Further Details:      
 
Domain Number 4 Region: 586-677
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000428
Family Growth factor receptor domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015551   Gene: ENSMPUG00000015661   Transcript: ENSMPUT00000015792
Sequence length 796
Comment pep:novel scaffold:MusPutFur1.0:GL896996.1:4576946:4590249:1 gene:ENSMPUG00000015661 transcript:ENSMPUT00000015792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRPWLLWVVAAAGALVLLAADARAQKVYTNTWAVHIPGGPAVADRLARKHGFLNLGQI
FGDYYHFWHRAVTKRSLSPHHPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQ
QWYLQSGVTQRDLNVKEAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQD
PDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARS
LGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGRE
HDSCNCDGYTNSIYTLSISSATQLGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQK
CTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRK
VSHSYGYGLLDAGAMVTLAQNWTTVPPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPS
HITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSW
DEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGPHTPPESSGCKTLTTSQACVVC
EEGFSLHQKTCVQHCPPGFTPQVLDTHYSTENDVETIRASVCTPCHSSCATCQGLAPTDC
LSCPSHASLDPVEQTCSRQSQSSRESPQQRPPPQRLPTEVEAEPRPRAGLLPSHLPEVVA
GLSCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEED
EGRGERTAFIKDQSAL
Download sequence
Identical sequences M3YW41
ENSMPUP00000015551 XP_004763757.1.14098 XP_004763758.1.14098 ENSMPUP00000015551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]