SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015624 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015624
Domain Number 1 Region: 373-726
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-87
Family Protein kinases, catalytic subunit 0.00000174
Further Details:      
 
Domain Number 2 Region: 188-288
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 3.66e-42
Family MAST3 pre-PK domain-like 0.00000212
Further Details:      
 
Domain Number 3 Region: 964-1054
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-18
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015624   Gene: ENSMPUG00000015733   Transcript: ENSMPUT00000015865
Sequence length 1326
Comment pep:novel scaffold:MusPutFur1.0:GL896974.1:6203195:6239359:-1 gene:ENSMPUG00000015733 transcript:ENSMPUT00000015865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEPSLLRRRGLQKELSLPRRGRGCRSGNRKSLVVGTPSPTLSRPLSPLSVPTGNSPLDS
PRNFSAASAVNFPFARSHIPRVERADGRRWSLASLPSSGYGTNTPSSTVSSSSSSRERLH
QLPFQPTPDELCFLSKHFRSSESVVDEEGGHRSPHLRPRSRSLSPGRTTGTFDNEIVMMN
HVYRERFPKATAQMEGRLQEFLAAFAPGARLALADGVLGFIHHQIIELARDCLAKSGEAL
VTSRYFLEMQEKLERLLQDAHERSDSEEVSFIVQLVRKLLIIISRPARLLECLEFDPEEF
YHLLEAAEGQAREGQGIKTDLPQYIIGQLGLAKDPLEEMVPLSHLEEEGQPPAPESPESR
ALIGPSRRKPCESDFETIKLISNGAYGAVYLVRHRDTRQRFAIKKINKQNLILRNQIQQV
FVERDILTFAENPFVVSMFCSFETRRHLCMVMEYVEGGDCATLLKNMGPLPVDMARMYFA
ETVLALEYLHNYGIVHRDLKPDNLLITSLGHIKLTDFGLSKIGLMSMATNLYEGHIEKDT
REFVDKQVCGTPEYIAPEVIFRQGYGKPVDWWAMGVVLYEFLVGCVPFFGDTPEELFGQV
VSDEIMWPEGDEALPADAQDLITRLLRQSPLDRLGTGGTHEVKQHPFFWTLDWAGLLRHK
AEFVPQLEAEDDTSYFDTRSERYRHLGSEDEETNDEESSAEIPQFSSCSHRFSKVYSSSE
FLAVQPTPTFAERSFSEDREEGWERSGEVDYRRRLSLNTSLSTGLSTGLSTEIRLRSWTS
SGSSCQSSSSQPERGPSPSLLNTISLDTMPKFAFSSEDEGASTASVGPKRPIFILGEPDP
PPAATPVMSKPSSLSADTAALSHARLRSNSTGARHSTPRALDAGRGRRLGGSREPAPEKS
RVSPSGGRVPKSASVSALSLIITADDGSGGPLMSPLSPRSLSSNPSSRDSSPSRDPSPVC
GSLRPPIVIHSSGKKYGFSLRAIRVYMGDSDVYTVHHVVWNVEEGSPAQEAGLRAGDLIT
HINGESVLGLVHMDVVELLLKSGNKIALRTTALENTSIKVGPARKNVAKGRMARRSKRSR
RRETQDRRKSLFKKISKQSSVLHTSRSFSSGLHHSLSSSESLPGSPTHSLSPSPTTPCRS
PAPDVPAGTDTTSPPSVSPSSSSPASPAASGHTRPSSLHGLAAKLGPPRPKTGRRKSTSS
IPPSPLACPPVPVPPPRSPSPLPGHPPAPARSPRLRRGQSADKLGSGERLDGESGRRGRG
PDSELVVMRRLHLSERRDSFKKQEAVQEVSFDEPPEEATGPLTSVPQIAVEGAEAVLGTL
GPAGKD
Download sequence
Identical sequences M3YWB4
ENSMPUP00000015624 ENSMPUP00000015624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]