SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015837 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015837
Domain Number 1 Region: 590-891
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-83
Family Protein kinases, catalytic subunit 0.0000000000861
Further Details:      
 
Domain Number 2 Region: 1-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.96e-75
Family Ephrin receptor ligand binding domain 0.0000000149
Further Details:      
 
Domain Number 3 Region: 301-506
Classification Level Classification E-value
Superfamily Fibronectin type III 4.98e-41
Family Fibronectin type III 0.0000216
Further Details:      
 
Domain Number 4 Region: 887-961
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.32e-21
Family SAM (sterile alpha motif) domain 0.0000281
Further Details:      
 
Domain Number 5 Region: 230-301,339-358
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000174
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015837   Gene: ENSMPUG00000015942   Transcript: ENSMPUT00000016078
Sequence length 963
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:22941267:23060824:-1 gene:ENSMPUG00000015942 transcript:ENSMPUT00000016078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTTATAELGWIVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRRGA
HRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADYDSATKTFPNWMENPWVKVDTIAA
DESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRVIQN
GAVFQETLSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAA
ENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTT
IPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAP
RQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMH
QVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAI
YVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAI
VCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKI
EQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVI
HLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYV
HRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKF
TSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCW
QKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLE
AIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQS
VEV
Download sequence
Identical sequences M3YWX7
ENSMPUP00000015837 ENSMPUP00000015837 XP_004741281.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]