SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015852 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015852
Domain Number 1 Region: 553-838
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-81
Family Protein kinases, catalytic subunit 0.00000000347
Further Details:      
 
Domain Number 2 Region: 1-128
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.23e-53
Family Ephrin receptor ligand binding domain 0.0000104
Further Details:      
 
Domain Number 3 Region: 253-460
Classification Level Classification E-value
Superfamily Fibronectin type III 7.51e-40
Family Fibronectin type III 0.00000393
Further Details:      
 
Domain Number 4 Region: 859-926
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.8e-20
Family SAM (sterile alpha motif) domain 0.0000349
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015852
Domain Number - Region: 184-250,285-307
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00213
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015852   Gene: ENSMPUG00000015957   Transcript: ENSMPUT00000016093
Sequence length 930
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:23213300:23243437:-1 gene:ENSMPUG00000015957 transcript:ENSMPUT00000016093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGA
STQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACLAIL
SLRIYYKKCPTMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLV
PIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPLHSHSAAPAAQACHCDLSYYR
ASLDPPSAACTRPPSAPVNLISSVNGTSVTLEWAPPLDLGGRNDITYNAVCRRCPWALGH
CETCGSGPRFVPQQTSLVRASLMVANLLAHMNYSFWIEAVNGVSDLSPEPRRAAVVNITT
NQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTT
RATVSGLKPGTRYMFQVRARTSAGCGRFSQAMEVETGKPRPRYDTRTIVWICLTLITGLV
VLLLLLICKKRHCGYSKAFQDSDEEKMQYQNGQAPPPVFLPLHHPPGKIPEPQFYAEPHN
YEEPGRAGRSFTREIEASRIHIEKIIGSGESGEVCYGRLRVPGQRDVPVAIKALKAGYTE
RQRQDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGSLDAFLRTHDGQFTIA
QLVGMLRGVGAGMCYLSDLGYVHRDLAARNVLVDSNLVCKVSDFGLSRVLEDDPGAAYTT
TGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGY
RLPAPMGCPRALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPESLRATATVNRCPPPA
FAQSCFDLRGGGSGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMDAQDVRALGI
TLMGHQKKILGSIQTMRAQLTNTQGPRRHL
Download sequence
Identical sequences M3YWZ2
ENSMPUP00000015852 ENSMPUP00000015852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]