SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016026 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016026
Domain Number 1 Region: 136-266
Classification Level Classification E-value
Superfamily GAT-like domain 9.02e-45
Family Phosphoinositide-binding clathrin adaptor, domain 2 0.00000167
Further Details:      
 
Domain Number 2 Region: 5-131
Classification Level Classification E-value
Superfamily ENTH/VHS domain 4.36e-36
Family Phosphoinositide-binding clathrin adaptor, N-terminal domain 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016026   Gene: ENSMPUG00000016133   Transcript: ENSMPUT00000016270
Sequence length 443
Comment pep:novel scaffold:MusPutFur1.0:GL897199.1:531166:570555:-1 gene:ENSMPUG00000016133 transcript:ENSMPUT00000016270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSASKAALGATTDEPMEPKAKHLADLIQYINGTNMSVDHLADVLSEKTGNSSWVVVFK
ALVTVHHLMVHGNERFIQHLASRNSLFTLHNFLDKSVIEGYTMSTFIRRYSRYLNEKSLA
YRLIASDITKTKRGTDGTMRTMDTKRLLNTLPVIQTQFDALLNFNANPDELTNGIIHAAF
MLLFKDSLRLFAAYNEGILNLLDKYFDMRKNQCKESLDIYIKFLERTAKLAQFLKVAEQV
GIDQNDIPYLTQAPHSLLEALKQHLASLEEKNDSWSPYSLQHALIPSIPNNPVVNASASG
AWFAAHKSVEARQQHGKITAKNLDGSLVNLVGNLNLGESPVNRLDMEWPQPSEMEIAGGM
KWQLNTYTCTSTLWKHISIPPVPHMVLPPVGYPVTSQQVPMYRMVHTPKGALFLMAPQPM
IHGQPGSRTSNSAPSTRNNTQSM
Download sequence
Identical sequences M3YXG6
ENSMPUP00000016026 ENSMPUP00000016026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]