SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016036 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016036
Domain Number 1 Region: 262-446
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.71e-52
Family Nucleotide and nucleoside kinases 0.0000055
Further Details:      
 
Domain Number 2 Region: 121-253
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-33
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 51-138
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-20
Family PDZ domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016036   Gene: ENSMPUG00000016141   Transcript: ENSMPUT00000016280
Sequence length 450
Comment pep:novel scaffold:MusPutFur1.0:GL897199.1:811152:823481:1 gene:ENSMPUG00000016141 transcript:ENSMPUT00000016280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLCCSLTRCFVVWTCQAVAHQANAVTEDMYTNGSAAPGSPTQAKGQEVRKVRLIQFEK
VTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKA
MKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDHLIPCKEAGLKFVTGDIIKIIN
KDDSNWWQGRVEGSSKESAGLIPSPELQEWRVASVAQSAPSEAPSCSPFGKKKKYKDKYL
AKHSSIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKNALLSQNPDKFAYPAPY
TTRPPKKNEEDGKEYHFISAEEMARSISANAFLEFGSYQGNMFGTKFETVHQIHEQDKIA
ILDIEPQTLKIVRTAELSPFIVFIAPTDQGAQTEALQQLQKDSEAIRGRYAHYFDLSLVN
NGVDETLKKLQEAFDQACTSPQWVPVSWVY
Download sequence
Identical sequences M3YXH6
ENSMPUP00000016036 ENSMPUP00000016036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]