SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016175 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016175
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-56
Family Necap1 N-terminal domain-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016175   Gene: ENSMPUG00000016278   Transcript: ENSMPUT00000016419
Sequence length 266
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:27825201:27843808:-1 gene:ENSMPUG00000016278 transcript:ENSMPUT00000016419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGEYESVLCVKPEVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQVAYIKLE
DRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFVDRGDAFDFNV
ALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGTPRARPA
STGGLSLLPPPPGGKTSTLIPPPGEQVSVGGSLVQTAVGPSSGGATVSWPQPRPATTATT
DIWGDFTKSTGSTSSQTPPGTGWVQF
Download sequence
Identical sequences M3YXW5
ENSMPUP00000016175 XP_004741433.1.14098 ENSMPUP00000016175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]