SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016215 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016215
Domain Number 1 Region: 148-207
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000073
Family LIM domain 0.0092
Further Details:      
 
Domain Number 2 Region: 204-270
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000114
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016215
Domain Number - Region: 71-76
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0628
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016215   Gene: ENSMPUG00000016318   Transcript: ENSMPUT00000016459
Sequence length 271
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:28395778:28407235:-1 gene:ENSMPUG00000016318 transcript:ENSMPUT00000016459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPPARAAATRPAVSPQLSNGGCSLPPPPLDGEDTLPDLDLLPPPPPSPDEQLPASMGASL
ISDLEQLHLPPPPPPPQSLTEAPPPQPRPGLARPAEDELPPPPEETVGFHEREASTAKCA
MIAKCLGFFHYKIKRTERQCKVSPLSHLCVSRFPGQSFYQKDGRPLCEPCYQDTLEKCGK
CGEVVQEHIIRALGRAFHPACFTCVTCARCIGDESFALDNQDEVYCLDDFYRKFAPVCSI
CENPIIPRDGKDAFKIECMGRNFHENCYRCE
Download sequence
Identical sequences M3YY05
ENSMPUP00000016215 ENSMPUP00000016215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]