SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016226 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016226
Domain Number 1 Region: 612-716
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-20
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016226   Gene: ENSMPUG00000016329   Transcript: ENSMPUT00000016470
Sequence length 862
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:28433356:28446021:-1 gene:ENSMPUG00000016329 transcript:ENSMPUT00000016470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDYYKPQYLLDFEDRLPSSVQGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEDYDFGDVF
PAVPSVPSTDWEDGDLTDTVSGPRSTTSDPTSSKASTKSPTQRHNPFSEDPAETVSSSDT
TPVHTTSQEKGESHTLDLPDTCTELEVIRVTKKKKTGKKKKTRSDEEASPLHPASTQDTG
ARRGDGDSLVSSPGLGRASPDATITPPQEEGEGPGSTAESSELSEPGQMGLLIPEMKDTS
MERLGQPLSKVIDQLNGQLDPSTWRSHVQSPDQSFRTGSPGEAPEKPPFCDFSEGLPAPM
DFYRFTVESPSTLTAGGSNHDSAGPGQPLHVPGSPATAGQEEGGGGREGQTPGPLEDAPP
REAPEPGTQEPDAKLPLVGEGPEPELEPGTHETLCQLKRDQPSPCLSSAEDSGVDEGQGS
PSDMSHSAEFRVDNNHLLLLMIHVFRENEEQLFKMIRMSTGHMEGNLQLLYVLLTDCYVY
LLRKGAAEKPYLVEEAVSYNELDYVSVGLDQQTVKLVCTNRRKQFLLDTADVALAEFFLA
SLKSAMIKGCREPPYPSVLTDATMEKLALAKFVAQESKCEATAVTVRFYGLVHWEDPMDE
SLGPIPCHCSPPEGVITKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVTPL
LSVNMGGEQCGGCRRANTTDRPHAFQVILADRPCLELSADSEADMADWMQHLCQAVSKGV
IPQGVTPSPCIPCCLVIAADRLFTCHEDCQTSFFRSLGTAKLADVSAVATEPGKEYCVLE
FSQDSQQALPPWVIYLSCTSELDRFLSALSSGWKTIYQVDLPHKAIQEASNKKFEDALSL
IHSAWQRSDSLCRGRASRDPWC
Download sequence
Identical sequences M3YY16
ENSMPUP00000016226 ENSMPUP00000016226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]