SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016239 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016239
Domain Number 1 Region: 177-450
Classification Level Classification E-value
Superfamily Caspase-like 3.44e-88
Family Caspase catalytic domain 0.000000000444
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily DEATH domain 2.35e-24
Family Caspase recruitment domain, CARD 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016239   Gene: ENSMPUG00000016342   Transcript: ENSMPUT00000016483
Sequence length 451
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:28597331:28617146:1 gene:ENSMPUG00000016342 transcript:ENSMPUT00000016483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEADRQILRRCRVQLVNELQVAPLWDVLLTRQLFTPAMIEDIQHAGSGSRSDQARQLVI
DLETRGSQALPLFISCLEDTDQNKLASVLRALRQAEKQNPEVIRPQDPMPVVVRALGLTP
EDLRGKQGPSKATPGKLAPVVLGPEQLWPAKLRPEVLRPEMPRPVDSGSGRFSDVCAPEI
SKQNADLAYALNADPCGHCLIINNVNFCLESRLTARTGSNIDCEKLRQRFHLLHFMVEVK
CDLTAKQMVQALVELARRDHSALDCCVVVVLSHGCQASHLQFPGAVYGTDGCPVAIERIV
NIFNGAGCPSLGGKPKLFFIQACGGEQKDHGFEVASASPEDRTPGSDPESDAVPFQEGPG
PCDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDTKSGSWYVETLDGVFEQWAHSEDLQTLL
LRVANAVSQKGIYKQIPGCFNFLRKKLFFKV
Download sequence
Identical sequences M3YY29
XP_004741476.1.14098 ENSMPUP00000016239 ENSMPUP00000016239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]