SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016482 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016482
Domain Number 1 Region: 629-639,666-1028
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 7.06e-97
Family Formin homology 2 domain (FH2 domain) 0.0000222
Further Details:      
 
Domain Number 2 Region: 103-184
Classification Level Classification E-value
Superfamily PDZ domain-like 2.66e-22
Family PDZ domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016482   Gene: ENSMPUG00000016585   Transcript: ENSMPUT00000016727
Sequence length 1044
Comment pep:novel scaffold:MusPutFur1.0:GL897102.1:1952440:1971574:-1 gene:ENSMPUG00000016585 transcript:ENSMPUT00000016727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDQGFSRHFRIFIPKKHRARFDEVVSQGLLGKLCRARRAQGAQGLRRSRSEERPERLL
VSTRASAAPRRXXXXXXXXXXXXXXXXXXXXXSLLGGRAGPGGTRRTVRVYKGNKSFGFT
LRGHGPVWIESVLPGSPADNASLKSGDRILFLNGLDMRNCSHDKVVSMLQGSGAMPTLVV
EEGLVPFASDSDSLDSPNPSSALTSLQWVAEILPSSIRVQGRTFSQQLEHLLTPPERYGI
CRALESFFQHRNIDTLIVDVYPVLDTPAKQVLWQFIYQLLTYEEQELCQEKIACFLGYTA
MTEPEPELDLEPELEPEPEPVPELQRRSSLRASSMCRRSLRSQGLEASLSCGPGDCPEMP
LPLIPGERQAGDGTSLPETPNPKMMSAVYAELESRLNSSFKGKVGTTSRSRASPPVPSPV
GPAGPRTLSSISWPSERLLPSPCYYPLCSGGLASPSSSESHPYASLDSSRAPSPQPDPGP
IRSDSPPSPDPARPPSRRKLFTFSRPVQSRDTDRFLDVLSEQLGSRVTVVDDFLSPENDY
EEMSFHDDQGSFVTNERSSASECISSSEEGSSLTYSSISDHIPPPPLSPPPPPPLPFHDP
KPSSRTPDGPRGPPQTLAKPLTQLSHPVPPPPPPPLPPPVPCAPPMLSRGLGHRRSETSH
MSVKRLRWEQVENSEGTIWGQLGEDSDYDKLSDMVKYLDLELHFGTQKPAKPVPGPEPFR
KKEVVEILSHKKAYNTSILLAHLKLSPAELRQVLMSMEPRRLERAHLAQLLLFAPDADEE
QRYQAFREAPGRLSEPDQFVLQMLSVPEYKTRLRSLHFQATLQEKTEEIRGSLECLRQAS
LELRNSRKLAKILEFVLAMGNYLNDGQPKTNKTTGFKINFLTELNSTKTVDGKSTFLHIL
AKSLSQHFPELLGFAQDLPTVPLAAKVNQRALTSDLADLHGTISEIQAACQSMCPSSEDK
FAVVMTSFLETAQPVLRALDGLQREAMEELGRALAFFGEDSKATTSEAFFGIFAEFMSKF
ERALSDLEAGDGPRSSGMVSPLAW
Download sequence
Identical sequences M3YYS2
ENSMPUP00000016482 ENSMPUP00000016482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]