SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016550 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016550
Domain Number 1 Region: 59-164
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.53e-25
Family Ras-binding domain, RBD 0.0034
Further Details:      
 
Domain Number 2 Region: 931-1038
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-24
Family PDZ domain 0.0000227
Further Details:      
 
Domain Number 3 Region: 244-351
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000000542
Family FHA domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016550   Gene: ENSMPUG00000016653   Transcript: ENSMPUT00000016796
Sequence length 1050
Comment pep:novel scaffold:MusPutFur1.0:GL897102.1:2859477:2933593:1 gene:ENSMPUG00000016653 transcript:ENSMPUT00000016796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYGAHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDTTFSSLGASDDPAELSTQLS
APGVLKVFGDSVCTGTHYKSVLATCMSSAQELVKEALERYALSPECASQYVLCDVVGQAG
GSGQQWQAECFRVFGDNEKPLLIQELWKPREGLSRRFELRKKSDVEELAAKDVDTMTAGI
NAQARRLQRHRAKGTPVLAPGGARSPPTPRLRRTVSESSLSSAATQGPEERARDTMRFSL
YESPHLLLLQGYSQQHDSLVYLLNREQHTVGQRTPSSKPSVSLSAPDILPLHCTIRRHQT
PGPEPAASRLVLEPIPGAPVSVNFAEVGGRAVVLRHGDLLSLGLYYLLLFKDPAQAQPLP
AQALARLRAIPRSCGLCGAALRARGASASGSAPATLPRPRLLHLEFEPEVEDALLQRILT
LVEPGGDDHKLAPAFLLCLCIQHSATRLEPGSFGQLLLKIAKAIRETVWEKTKELAEKQA
QLQEPLSLASFPMAGLVPDLQHILFWMSNSVELLYFIQQKCPLYMQSLEEELDVTGSRES
LFSCALTASEEAMAALEEVILHAFQQCVYYVSKSLYVCLPALLECPPFQTERRESWCSAP
QLPEELRHVVSVYQATMDLLRQFRVHPEIASQVLAYLFFFSSTLLFNQLLDKGPSLSCFH
WPRGVQACARLQQLLEWMRSAGHGEAGERFFRKLSCTLNLLATPRAQLIQMSWANLRAAF
PTLSPAQLHRLLTQYQLASAVGPMSAWEPGAQDSPEAFKSEEVLESYENPPPIVLPSEGF
QVDLEADCLDDSIYQHLLYIRHFLWSLRSKPSPSGGSSQSGGLEGPHHTTSEGQSGPLVC
RGAREAGQGRPLASAGAPRAGGLSGRQSRGGPQAGPLHVDSSCLLTPPSTPLSLEPTGPD
WPEPRGTCGKVLLEGRRNAAPGGDSVGPADEPPAAPSSRSSSTEDFCYVFVVELERGPSG
LGMGLIDGLHTPLGAPGLYIQTLLPGSPAASDGRLSLGDRILEVNGSSLAGVSYLRAVNL
IRNGGKKMRFLVAKSDVETAKKIRFRTPPS
Download sequence
Identical sequences M3YYZ0
XP_012902562.1.14098 ENSMPUP00000016550 ENSMPUP00000016550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]