SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016742 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016742
Domain Number 1 Region: 15-118
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-21
Family PDZ domain 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016742   Gene: ENSMPUG00000016847   Transcript: ENSMPUT00000016991
Sequence length 290
Comment pep:novel scaffold:MusPutFur1.0:GL897231.1:952677:964985:1 gene:ENSMPUG00000016847 transcript:ENSMPUT00000016991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKRTDLASGETQTGFNVKSSVHNLSKTQQTKLTVGNLGLGLIVIQNGPYLQITHLIRNGA
AARDGKLKPGDVLISVGHANVLGYTLREFLKLLQHITIGTVLQIKIYRDFIDIPQEWQEI
YDLIPETKFPVTCPTKKTEESKDDLLASSDDNEDVVSDKNLKYYKDPGSPGPQSATRPMS
ISREWHGYKKENQTISVGKDIQSDVMIHRDHKKEVRAPSPYWTMVKHDKESSSSSTASST
SDAFWMEDYAQAEKSKVPPVSKAPTQAEKSKVPPVSKAPTQXXXXXXXPG
Download sequence
Identical sequences M3YZI2
ENSMPUP00000016742 ENSMPUP00000016742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]