SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016835 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016835
Domain Number 1 Region: 913-1010
Classification Level Classification E-value
Superfamily PDZ domain-like 9.07e-26
Family PDZ domain 0.0000857
Further Details:      
 
Domain Number 2 Region: 763-868
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-25
Family PDZ domain 0.0000944
Further Details:      
 
Domain Number 3 Region: 229-335
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-24
Family PDZ domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 599-699
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-23
Family PDZ domain 0.00037
Further Details:      
 
Domain Number 5 Region: 392-505
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-22
Family PDZ domain 0.00022
Further Details:      
 
Domain Number 6 Region: 67-108
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000341
Family WW domain 0.0011
Further Details:      
 
Domain Number 7 Region: 125-164
Classification Level Classification E-value
Superfamily WW domain 0.000000000431
Family WW domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016835
Domain Number - Region: 175-217
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00314
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016835   Gene: ENSMPUG00000016939   Transcript: ENSMPUT00000017084
Sequence length 1063
Comment pep:novel scaffold:MusPutFur1.0:GL896899.1:14386286:14644643:-1 gene:ENSMPUG00000016939 transcript:ENSMPUT00000017084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNAGIVHAENEEEDDVPEMNSSFTADSGDQEEHTLQETALPPVNSGIAAAPITDASQKF
PQYLPLCAEDNLGPLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDD
EGVHTEELDSELELPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLEQQQPPQ
PPQQPQQTQQPPQPQPEEWTEDHSSLVPPVIPNHPPSNPEPAREAPLQGKPFFTRNPSEL
KGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTC
VLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQ
ETYDSPASHSSKTGKVNGMKDARPSSPADVASNGSHGYPNDTVSLASSIATQPELITVHI
VKGPMGFGFTIADSPGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKKNVQALTHNQVVDML
IECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSCHRSLHTASPGHSTQV
LPEYPPAEAPTPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGVSKGERERESNP
TSFGECQIPDYQEQDIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGD
ELICVDGTPVIGKSHQLVVQLMQQAAKQGHVNLTVRRKVVFAAPKAENEVPSPASSHHSS
NQPASLTEEKRTPQGSQNSLNTVSSGSGSTSGIGSGGGGGSGVVSTAVQPYDVEIRRGEN
EGFGFVIVSSVSRPEAGTTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCS
ITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGAQETR
NTTKPKPESQFEFKAPQATQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGP
AERCGKMRIGDEILEINGETTKNMKHSRAIELIKNGGRRVRLFLKRGDGSVPEYAMIPPN
LAACMRNEKLGEACFYLMGHNQTTTPAATGTAPPPPVHKVFRK
Download sequence
Identical sequences M3YZS4
ENSMPUP00000016835 ENSMPUP00000016835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]