SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017142 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017142
Domain Number 1 Region: 927-1149
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-39
Family DBL homology domain (DH-domain) 0.0017
Further Details:      
 
Domain Number 2 Region: 1305-1506
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-33
Family Pleckstrin-homology domain (PH domain) 0.0000972
Further Details:      
 
Domain Number 3 Region: 1136-1253
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-23
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017142   Gene: ENSMPUG00000017250   Transcript: ENSMPUT00000017396
Sequence length 1508
Comment pep:novel scaffold:MusPutFur1.0:GL896899.1:36236704:36358191:-1 gene:ENSMPUG00000017250 transcript:ENSMPUT00000017396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRADSPKPPVAPKPKTASPLTPVTAPKFPSSPRPDSLHSPNSMSRGPKPPIAPKPRLAT
PSEWRASVYVINSLNKCSNGKLLCVDRGLYEEHRSNLECSESEADEDYIVVPKSPPKEDG
PSDSSSAENAVMVPPDAAGGEDCQEGGKGSDPEGMGAAEDLAAPAEVVPSEEADGGTAPT
PENVGAEDGACDPGAEEQRFTSEEEEKLVEEHNVYNLEDRGPWDGEAVLPSDILTHIDLE
APANPSDEPGPPGTPREAEEDGEEGSASTEPGAPDECVNSDGPPEGDAEDDSKEPTENEG
LATGVQEVEMATDSPEVSEERGEDATASGDQDEPHDQNEKTDQEEMAAVTQEEGGDPREG
EELVQDEPAEESCQIIPYENDGMDDFVTSLSGSPYELFPTESTSFCSESYSSFPKSAKDL
ESQQEPQSGECAEQDPTVGTSCDSEEGPSVPDVVVMPEDEDAIDDALTNPYEMGVDLEQG
ANPEEGEKPETQAASDMLSGYGTKEEMNSDAEGGLVSIDRKNIITRTRPHSGKMAGYVPE
TVPEETGPEAGSSAIGIRGGNKEARKTALSLEGKPLEASRALPAKPRAFTLYPRSFSVEG
REIPVSLYRESEASSLDDHRIKRKDDNLSLPCMIGSSGSFSQRNHLPSSGTSTPSSVVDI
PPPFDLACITKKPITKSSPSLLIESEPPDKHTKKKKSSFKRFLALTFKKKSENKVHVDVN
VSSSRSSSESSYHGPARLLEIDRRSLSNSPQLKARTGKLRASDSPSSLIFYRDGKRKGVP
FSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENIPAMNSDYENIQIPPRRP
ARAGTFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSADQEAESAYTEPYKVCPIS
AAAPKEDLSSDEEQGSSEEEDSAPRDPSLTHKVEGQSRAHVIAQELLSSEKAYVEMLQHL
HLDFHGAVMRALDETDQEGKDTLAREELRRGLSELPAIRDLHQGILEELGERLLHWEGQQ
KVADVFLAREQDFDHHATHILQFDRYLSLLSENCLHSPRLAAAVREFEQSQQGGGQNVKH
RLLRVVQRLFQYQVLLTDYLNNLSPDSAEYDNTQGALTLISKVTDRANDSMEQGENLQKL
VHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKSRRPRHLFLMSDVLLYTYPQKDGKYRLK
NTLSVASMKVSRPVMEKVPYALKIETSQSCLTLSASSCAERDEWHSCLSRALPEDYKAQA
LAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRN
CSRNKYPLKYLKDRMAKVCDGCYGELKKRGGDVPGLLRERPVSMSFPLSSPRFSSSAFSS
VFHSINPSTFKKQKKVPSALTEVAASGEGSAISGYLTRCKKGKRHWKKLWFVIKGKVLYT
YMASEDTVAMESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYSFKAEDNNSAQRWIK
AMEDASVL
Download sequence
Identical sequences M3Z0N0
XP_004738648.1.14098 ENSMPUP00000017142 ENSMPUP00000017142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]