SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017743 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017743
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.06e-27
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-27
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.99e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-20
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 7 Region: 547-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.54e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 243-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000904
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017743   Gene: ENSMPUG00000017854   Transcript: ENSMPUT00000018003
Sequence length 608
Comment pep:novel scaffold:MusPutFur1.0:GL897126.1:2594205:2616168:1 gene:ENSMPUG00000017854 transcript:ENSMPUT00000018003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGLCKAMSQGLVTFRDVALDFSQEEWEWLDPSQKDLYRDVMLENYRNLVWLGLSISKP
NMISLLEQGKEPWMVQKEMSDGQYTDWESWYEIKELSPKWYIGEEEISQGMVKERLRSYD
VEYSSFREAWKYEGEFARHQQKERHFRQVTALKEISAVKMDKKYNNSERSVLLKSVLSPQ
ERVPTVQQVHKFGIYDKMFPPNSVLIERKRLPAEKDSLTDNECEEFNQSTYHSKDTGIRP
AEKPFESSDFSNLLSFHSLFTQHQTTHFGKLPRGFSECDDAFSCYSFFTQPQRIHTGEKP
FVCNDCGKAFSHDFFLSEHQRTHIGEKPYECKECNKAFRQSAHLAQHQKIHTGEKPFACS
ECGKAFSRYAFLVEHQRIHTGEKPYECKECNKAFRQSAHLNQHQRIHTGEKPYECNQCGK
AFSRRIALTLHQRIHTGEKPFKCNECGKTFGYRSHLNQHQRIHTGEKPYECIKCGKFFRT
DSQLNRHHRIHTGERPFECSKCGKAFSDALVLIHHKRSHAGEKPYECNKCGKAFSCGSYL
NQHQRIHTGEKPYECNECGKAFHQILSLRLHQRIHAGDKPYHCNECGNNFSCASALRRHQ
KIHNRETL
Download sequence
Identical sequences M3Z2D1
XP_004776319.1.14098 ENSMPUP00000017743 ENSMPUP00000017743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]