SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017953 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017953
Domain Number 1 Region: 536-606
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.69e-17
Family SAM (sterile alpha motif) domain 0.00087
Further Details:      
 
Domain Number 2 Region: 1068-1137
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000108
Family SAM (sterile alpha motif) domain 0.0095
Further Details:      
 
Domain Number 3 Region: 455-555
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000473
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017953   Gene: ENSMPUG00000018064   Transcript: ENSMPUT00000018215
Sequence length 1145
Comment pep:novel scaffold:MusPutFur1.0:GL896934.1:6259183:6452991:1 gene:ENSMPUG00000018064 transcript:ENSMPUT00000018215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWHSSMQIITTPVSPMCVRGWRSSGSGGFPRTWKWNTLPKSNSEDSSVGKGDWKKKNKY
FWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQLMMMVKEKMITIEEALARLKEY
EAQHRQSAALDPADWPDGSYPTFDGSSNCNSREQSDEETEESVKFKRLHKLVNSTRRVRK
KLIRVEEMRKPSTEGGEEHVFENSPGLDERSALYSGVHKKPFFFDGSPEKPPEDESDSLT
TSPSSSSLDTWGAGRKLVKTFSKGESRGLIKPPKKMGTFFSYPEEEKAQKVSRSLTEGEM
KKGLGSLSHGRTCSFGGFDLTNRSLHIGSNNSDPMSKEGDFVYKEVIKSPTASRISLGKK
VKSVKETMRKRMSKKYSSSVSEQDSGLDGMPGSPPPSQPDGEHMDKPKLKAGGSVESLRS
SLSGQSSMSGQTVSTTDSSTSNRESVKSEDGDDEEPPYRGPFCGRARVHTDFTPSPYDTD
SLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLNEEEEKPKRPTRRRRKGRPP
QPKSVEDLLDRINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVEL
LQEYDSNSDQSGSQEKLLVDSQGLSGCSPRDSGCYESSENLEHGKSRKTGLLSVKSSTES
SLKSFNRNQLGHYPTLPLTKSADALKQGEEGRLGSGLSPRASKCCDQPCGAGPNKNRRSL
PVSICRSCETLEGPQAVEAWPRSHSLDDLQGEPAAEKDVPGKVTDPCPQTVPQVPQKTTP
FIAKVQSPKRDPAVDNALLLTQSKRCSEPQKPATRKLEGSTAPSPRGASPPPCLPKTYDA
QHPGVKPSLTRMPLEGHRKGLEFEGTYHPPGTKEGLAAEQRGPETRAQAKHPAQPPPVPA
KKSRERLANGLHPSPPGPNAPSLPAKKGSPSDCHSPQASRPPSGQEPGSPLSARPPPWLS
ELPESTSLQEHGVKLGPALTRKISCARGVDLEMLTENKLRAEGIDLTEEPYSDKHGRCGI
PEALVQRYAEDLDQPERDVATHMDQIRVKLLQKQHRMAIPSGGLTEICRKPLSPGCISSV
SDWLVSIGLPMYTSALTEAGFSTLGQVPSLSHICLQEAGITEERHISKLMSAARLFKLPP
GPEAM
Download sequence
Identical sequences M3Z2Z1
ENSMPUP00000017953 ENSMPUP00000017953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]