SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018096 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018096
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.55e-41
Family Cofilin-like 0.0026
Further Details:      
 
Domain Number 2 Region: 375-431
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-18
Family SH3-domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018096   Gene: ENSMPUG00000018208   Transcript: ENSMPUT00000018360
Sequence length 432
Comment pep:novel scaffold:MusPutFur1.0:GL896901.1:14047994:14058823:-1 gene:ENSMPUG00000018208 transcript:ENSMPUT00000018360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSG
KVMYGFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACANHVSTMASFLKGAHVTINARAE
EDVEPECIMQKVARASGANYAFHKESGRFQDMGPQAPVGSVYQKTNAISEIKRVGKDSFW
AKAEKEEESRRLEEKRRAEEERQRLEQERRERELREAALREQRYREEQGSEAGPQSRKSE
QQEVVSRSREEQEPVSQPAHPREIFRQKERAMSTTSITSPQPGKLRSPFLQKQFTQPETL
RSPEPTQASSRPRADVPEDLAPSPPQCAVQAEEEAVYEEPPEQETVYEEPPMEQVPQQDA
GSEHVDHYPGLSGKGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHF
GMFPANYVELIE
Download sequence
Identical sequences M3Z3D4
XP_012915306.1.14098 ENSMPUP00000018096 ENSMPUP00000018096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]