SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018657 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018657
Domain Number 1 Region: 288-468
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-56
Family SPRY domain 0.0000407
Further Details:      
 
Domain Number 2 Region: 4-77
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-20
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 3 Region: 93-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000198
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018657   Gene: ENSMPUG00000018777   Transcript: ENSMPUT00000018929
Sequence length 472
Comment pep:novel scaffold:MusPutFur1.0:GL897113.1:2892297:2893715:1 gene:ENSMPUG00000018777 transcript:ENSMPUT00000018929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFMTALADLQTGASCPICLDYLKEPVTINCGHNFCLSCISMFWKDLNGTFPCPFCRHCS
PERKFTSNPQLSNLIEIAKLLRVRRSKRKRKEEKLICEKHNQVLTFFCQKDLEVLCPQCS
FSTDHRSHYIWPIEKAAPYHRKRLQNCIQPWKERVEQVEKVITMQSRKSLELKKKVQCRR
EEIKSEFEQILLFLKNEQEIVLRQLQDDEMDILTKLNENLTTFSSHLSTLKHLSKEIEGK
STKSELELLTDVKSIYHRYKTLKAPEPFSFQLKEYGYHLAPQYSGLNKIINRFQVDLILD
PETAHRKLIVSEDRKTVQYGNKRHNLPHNPRRFYLSPAILGSRGYNSGRQYWEVKVKDKP
EWIVGVCKDSLPRRKYQKQPILAQDGLWGVGRCSQSNYIALGPKKINLLPKVIPRKIGVF
LDCELCEISFYNLSDRSLLYIFNYYFTETLWPYFYTGTDSKPLKICTVTDSE
Download sequence
Identical sequences M3Z4Z5
XP_004775595.1.14098 ENSMPUP00000018657 ENSMPUP00000018657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]