SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018659 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018659
Domain Number 1 Region: 287-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-56
Family SPRY domain 0.0000461
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 2.43e-21
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 89-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000763
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000018659
Domain Number - Region: 123-211
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0915
Family HBL-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018659   Gene: ENSMPUG00000018779   Transcript: ENSMPUT00000018931
Sequence length 466
Comment pep:novel scaffold:MusPutFur1.0:GL897113.1:2997501:2998898:-1 gene:ENSMPUG00000018779 transcript:ENSMPUT00000018931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFVTGLVHLQEESSCPICLDYLKDPVTINCGHNFCRSCINMMWKDLDDTFPCPVCRFCF
HNKSFRSNRQLSNLTEIAKRLQVRRSKRKRQEYSMCEKHNQFLTLFCGKDLEVLCTQCSF
SVQHQKHYIYPIKKAATFHRKILEYSIEPLRDNVERVEKVLSLQTSKIVDLKRKVEDRRE
EIISEFEQIRQFLQNQQEALLRQMDDEERDILTKLNENQRTFSGHVSTLKHLLKEVECRC
VQSELELLTHIKGIYNRYQNLTYPELFVFQLKKYGFSLPPQYSGLDRIIKPFRADVMLDL
ETAHPQLIVSEDRKSVRYGNQKKHLCYNPRRFYLCPAVLGSRSFNSGRHYWEVEVGNKPK
WTLGVCRDRFPRNWRTWPVVEGGFWAIGRYIESIYVILGGKRTQLLPIVRPSKIGIFLDC
ELGEVSFYNMNDRSLLHNFNDSLIEAVCPYFYIGVDSEPLKISSVT
Download sequence
Identical sequences M3Z4Z7
ENSMPUP00000018659 ENSMPUP00000018659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]